[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81541.1


[Show Plain Result]

## Summary of Sequence Search
   1::147
  70::146  PF01035 0.0% 48.0519480519481  6-O-methylguanine DNA methyltransferase, DNA bindin 
   1::147


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MWVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLPLDYTGLSPAR
PF01035         ---------------------------------------------------------------------q


                         -         -         *         -         -         -         -:140
query           LRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWL
PF01035         ervlealreIpyGrvttYgeiAkalgkpkaaraVgralaanplalivPchRVvradgklggyagglerkk


                         +         -         -         -         -         *         -:210
query           LRFEGAL---------------------------------------------------------------
PF01035         elleeE----------------------------------------------------------------