[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81542.1


[Show Plain Result]

## Summary of Sequence Search
   1::349
  92::183  PF08486 0.0% 55.4347826086956  Stage II sporulation protein 
   1::349


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKRLLAWVGLLALVLAALGQKAPGLEALLVRVLLKEVALGEEVRLALPTGEVALRGQAEGVVVEGRPLPS
PF08486         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           WAVEGPYFALEGRPYRGGLVARVEGGRLLLVNVLPLEDYLLGVLPAEMPASFPEEALKAQAVLARTFAVR
PF08486         ---------------------kveegkltainevpleeYlkgVvasEmpasweleaLkAqAVaaRtyala


                         +         -         -         -         -         *         -:210
query           RLNPLAPYDLCATEACQVYLGLSAETPRHERAVRATEGRVLSYAGQVASALYHADSGGMTAGSEEVFQKA
PF08486         klekreakkgfdvcdtthcqvYqgleaetpkvkeAveaTrGev---------------------------


                         -         -         -         +         -         -         -:280
query           LPYLRPRPDPYAKGPKSVWQQAVRPEEAARALRALGYAPRGDDPPQVLEKSPSGRAWRVRLLGVEVRGPE
PF08486         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           AQRLLRLMGLPSAMAEFQGWLALGRGAGHGVGLSQWGAKGMAERGYGYREILGYYFPGTLLSPLEVAAR-
PF08486         ----------------------------------------------------------------------