[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81546.1


[Show Plain Result]

## Summary of Sequence Search
   1::916
 279::291  PF00515 0.0% 46.1538461538462  Tetratricopeptide repeat 
 301::327  PF00515 0.0% 37.037037037037  Tetratricopeptide repeat 
 334::347  PF00515 0.0% 35.7142857142857  Tetratricopeptide repeat 
 365::380  PF00515 0.0% 43.75  Tetratricopeptide repeat 
 508::534  PF00515 0.0% 33.3333333333333  Tetratricopeptide repeat 
 706::733  PF00515 0.0% 32.1428571428571  Tetratricopeptide repeat 
 276::292  PF07719 0.0% 35.2941176470588  Tetratricopeptide repeat 
 300::328  PF07719 0.0% 41.3793103448276  Tetratricopeptide repeat 
 333::348  PF07719 0.0% 43.75  Tetratricopeptide repeat 
 364::383  PF07719 0.0% 40  Tetratricopeptide repeat 
 443::465  PF07719 0.0% 21.7391304347826  Tetratricopeptide repeat 
 508::534  PF07719 0.0% 40.7407407407407  Tetratricopeptide repeat 
 580::605  PF07719 0.0% 23.0769230769231  Tetratricopeptide repeat 
 705::732  PF07719 0.0% 39.2857142857143  Tetratricopeptide repeat 
 734::758  PF07719 0.0% 32  Tetratricopeptide repeat 
   1::916


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPDELRLFLKERFGVQGPLSPGRFEAELAKRLGSPARRAPLLKAWRAYLAQGGREAVRSFYREVLKVPKG
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EALVYGMHLPHLEFYAKELPPRVEGRVLEVGAFTGALVGFLQRKRPDLEWHALDGVEEAVALGKKRVPEV
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPEAFWKRFAFFERLPLFARLLRPGGLLVYGHG
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PFLGKSPEGVEEGLRRLGFDRVERVGEGEYFLVLARKPEALAAVRLEEREAPPPEEAEEVAVALEEARAL
PF00515         --------------------------------------------------------------------ay
PF00515         --------------------------------------------------------------------ay
PF00515         --------------------------------------------------------------------ay
PF00515         --------------------------------------------------------------------ay
PF00515         --------------------------------------------------------------------ay
PF00515         --------------------------------------------------------------------ay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay
PF07719         -----------------------------------------------------------------lGlay


                         -         *         -         -         -         -         +:350
query           LEAGRYAEALALLPEEAEGEAAYLRGRALFALSRHAEAEEALRRALSEEAEDLRALALVELGEYERARGR
PF00515         lklgkydeAie---------alynlGnaylklgkydeAieyyekALe------lGnaylklgkydeA---
PF00515         lklgkydeAie---------alynlGnaylklgkydeAieyyekALe------lGnaylklgkydeA---
PF00515         lklgkydeAie---------alynlGnaylklgkydeAieyyekALe------lGnaylklgkydeA---
PF00515         lklgkydeAie---------alynlGnaylklgkydeAieyyekALe------lGnaylklgkydeA---
PF00515         lklgkydeAie---------alynlGnaylklgkydeAieyyekALe------lGnaylklgkydeA---
PF00515         lklgkydeAie---------alynlGnaylklgkydeAieyyekALe------lGnaylklgkydeA---
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--
PF07719         yklgdyeeAlea-------ealynlGlayyklgdyeeAleafekAlel----nlGlayyklgdyeeAl--


                         -         -         -         -         *         -         -:420
query           LEALAVRGGRYRLALGRVYLAQGRYADALRQFVESGLPEADLYTRETLERITERMRRFAREGEWAEVSRR
PF00515         --------------lGnaylklgkydeAie----------------------------------------
PF00515         --------------lGnaylklgkydeAie----------------------------------------
PF00515         --------------lGnaylklgkydeAie----------------------------------------
PF00515         --------------lGnaylklgkydeAie----------------------------------------
PF00515         --------------lGnaylklgkydeAie----------------------------------------
PF00515         --------------lGnaylklgkydeAie----------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------
PF07719         -------------nlGlayyklgdyeeAleafe-------------------------------------


                         -         -         +         -         -         -         -:490
query           AEFVEDLSPGLLTREMLRLGLRAALIQGLFARAERYARRLADLDEAEGFLGLALAALRVKSPLELRGGED
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------
PF07719         ----------------------ayyklgdyeeAleafekAleldP-------------------------


                         *         -         -         -         -         +         -:560
query           LKAVEPYLTEALSRAEIPEALLLLGVLREREGRFREALHLLERAAFRGEGEVAGMAYHHLAQVKRALRRP
PF00515         -----------------akalynlGnaylklgkydeAieyyekA--------------------------
PF00515         -----------------akalynlGnaylklgkydeAieyyekA--------------------------
PF00515         -----------------akalynlGnaylklgkydeAieyyekA--------------------------
PF00515         -----------------akalynlGnaylklgkydeAieyyekA--------------------------
PF00515         -----------------akalynlGnaylklgkydeAieyyekA--------------------------
PF00515         -----------------akalynlGnaylklgkydeAieyyekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------
PF07719         -----------------aealynlGlayyklgdyeeAleafekA--------------------------


                         -         -         -         *         -         -         -:630
query           LKEVLGDHKRAHALRAYPAPYLFRLAQEALEGGEEVLARELLSRARDAGLEAVAEEDLTGLIHLLERLEG
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------
PF07719         -------------------ealynlGlayyklgdyeeAleafekA-------------------------


                         -         +         -         -         -         -         *:700
query           PWAAFSVLYQALSRTPQPPLELLALAYRLSRAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAH
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           PQALEVLFDLAEHHEAQGDWRRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKA
PF00515         -----alynlGnaylklgkydeAieyyekALel-------------------------------------
PF00515         -----alynlGnaylklgkydeAieyyekALel-------------------------------------
PF00515         -----alynlGnaylklgkydeAieyyekALel-------------------------------------
PF00515         -----alynlGnaylklgkydeAieyyekALel-------------------------------------
PF00515         -----alynlGnaylklgkydeAieyyekALel-------------------------------------
PF00515         -----alynlGnaylklgkydeAieyyekALel-------------------------------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------
PF07719         ----ealynlGlayyklgdyeeAleafekAle-ayyklgdyeeAleafekAleldPnn------------


                         -         -         *         -         -         -         -:840
query           VGEGLKALGEEAPHLPEAPRDLLEEDLPRFHGEHLVVVGGHTQLRSRLVPFLEGRGLRVDWYDADTVGVG
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           KEALRRILNRLEKAHGLMIVSSYVGHDLSEPVRLEAERLGVPVHVIPGRARGTTGFLRALKQFAPEVLKR
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           ALKGVE----------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF00515         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------
PF07719         ----------------------------------------------------------------------