[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81585.1


[Show Plain Result]

## Summary of Sequence Search
   1::198
   8::189  PF02223 0.0% 50  Thymidylate kinase 
   1::198


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
PF02223         -------iEGlDGaGKttqaellkeklkeqgikvvltrepggteiGelirelllkeeeleelteallfaa


                         -         -         *         -         -         -         -:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
PF02223         driehleekikpalkqgktvivdRylfSslaYqgakegvdldlvlslnedvlld.kPdltflldvdpeva


                         +         -         -         -         -         *         -:210
query           VRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLLP------------
PF02223         lkRlrkrgeldeeeeeqldflrkvrekylelak.ekeriliidasksie---------------------