[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81728.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
  20::91   PF00575 0.0% 40.2777777777778  S1 RNA binding domain 
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MWYSGGTAGGFRARRRNVELEAGTVVEGRVVRVVSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEG
PF00575         -------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvg


                         -         -         *         -         -         -         -:140
query           DIVQVLIKGRDAKGRLDLSIKDLTPAPEGGAPPPRPRRLPKQSPEFENKLKSFLRGTGGFGGKGKKGGRK
PF00575         devevkvlkvdkerkriiLsi-------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KR--------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------