[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81760.1


[Show Plain Result]

## Summary of Sequence Search
   1::113
  11::107  PF02410 0.0% 40.2061855670103  Domain of unknown function DUF143 
   1::113


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVKTKEAVALIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQALERHLLEKLEEEDLRP
PF02410         ----------lelvvkaleekkaedivvldvsekssiadyfviatgkserhvkaiadevekelekekgde


                         -         -         *         -         -         -         -:140
query           RPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAERL---------------------------
PF02410         llkvegldeseWvllDlgdivvhifteeaReeynLEs---------------------------------