[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81794.1


[Show Plain Result]

## Summary of Sequence Search
   1::125
  18::88   PF03061 0.0% 42.2535211267606  Thioesterase superfamily 
   1::125


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEARTLELVFPEHTNPLGAAFGGFVLGLMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
PF03061         -----------------GivhgGvylalldeaaglalrslggsgqgvvvvelnidFlrpvrlgdvltvea


                         -         -         *         -         -         -         -:140
query           VVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVEAHAGTD---------------
PF03061         rvlrlgrtsavvevevrd----------------------------------------------------