[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81826.1


[Show Plain Result]

## Summary of Sequence Search
   1::443
   5::284  PF07992 0.0% 36.0406091370558  Pyridine nucleotide-disulphide oxidoreductase 
   4::34   PF00070 0.0% 41.3793103448276  Pyridine nucleotide-disulphide oxidoreductase 
  65::90   PF00070 0.0% 15.3846153846154  Pyridine nucleotide-disulphide oxidoreductase 
 151::228  PF00070 0.0% 42.8571428571429  Pyridine nucleotide-disulphide oxidoreductase 
   5::43   PF01266 0.0% 36.1111111111111  FAD dependent oxidoreductase 
  59::118  PF01266 0.0% 24.5614035087719  FAD dependent oxidoreductase 
 152::182  PF01266 0.0% 48.3870967741936  FAD dependent oxidoreductase 
 195::257  PF01266 0.0% 37.0967741935484  FAD dependent oxidoreductase 
 133::169  PF02852 0.0% 21.6216216216216  Pyridine nucleotide-disulphide oxidoreductase, dime 
 329::431  PF02852 0.0% 30  Pyridine nucleotide-disulphide oxidoreductase, dime 
   4::36   PF03486 0.0% 32.258064516129  HI0933-like protein 
  65::122  PF03486 0.0% 31.4814814814815  HI0933-like protein 
 152::184  PF03486 0.0% 36.3636363636364  HI0933-like protein 
 194::242  PF03486 0.0% 32.6530612244898  HI0933-like protein 
   5::36   PF00890 0.0% 40  FAD binding domain 
  58::117  PF00890 0.0% 31.6666666666667  FAD binding domain 
 153::181  PF00890 0.0% 34.4827586206897  FAD binding domain 
 261::288  PF00890 0.0% 46.4285714285714  FAD binding domain 
 152::237  PF02737 0.0% 27.1604938271605  3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 
   1::443


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGKRMVVVGGVAGGASAAAKAKRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRK
PF07992         ----vviIGgGpaGlaaakrlarl..glkvalierepggtclnrgcipkkllleaaeeeeldlkeleerk
PF00070         ---rvvvvGgGyiGlElAaalaklg..kkVtvie------------------------------qkklek
PF00070         ---rvvvvGgGyiGlElAaalaklg..kkVtvie------------------------------qkklek
PF00070         ---rvvvvGgGyiGlElAaalaklg..kkVtvie------------------------------qkklek
PF01266         ----vviiGgGivGlstAyeLar..rglkVtllekg.diasga---------------klvkalaraaee
PF01266         ----vviiGgGivGlstAyeLar..rglkVtllekg.diasga---------------klvkalaraaee
PF01266         ----vviiGgGivGlstAyeLar..rglkVtllekg.diasga---------------klvkalaraaee
PF01266         ----vviiGgGivGlstAyeLar..rglkVtllekg.diasga---------------klvkalaraaee
PF02852         ----------------------------------------------------------------------
PF02852         ----------------------------------------------------------------------
PF03486         ---dviviGgGaAGlmaAisa..akrgakVllldka----------------------------lkelke
PF03486         ---dviviGgGaAGlmaAisa..akrgakVllldka----------------------------lkelke
PF03486         ---dviviGgGaAGlmaAisa..akrgakVllldka----------------------------lkelke
PF03486         ---dviviGgGaAGlmaAisa..akrgakVllldka----------------------------lkelke
PF00890         ----vvViGsGlAGlaAAleaae..aglkvavveke---------------------hallarllesare
PF00890         ----vvViGsGlAGlaAAleaae..aglkvavveke---------------------hallarllesare
PF00890         ----vvViGsGlAGlaAAleaae..aglkvavveke---------------------hallarllesare
PF00890         ----vvViGsGlAGlaAAleaae..aglkvavveke---------------------hallarllesare
PF02737         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
PF07992         degievllntgvtdidkakkkveladgka....evkydklviAtGakprtlgipGvelagkgvl.tseda
PF00070         ngievllntkveeiegsadg--------------------------------------------------
PF00070         ngievllntkveeiegsadg--------------------------------------------------
PF00070         ngievllntkveeiegsadg--------------------------------------------------
PF01266         lGveiiegtkVtglereggrvsgvrtedgsira...dkvvlAaGawss----------------------
PF01266         lGveiiegtkVtglereggrvsgvrtedgsira...dkvvlAaGawss----------------------
PF01266         lGveiiegtkVtglereggrvsgvrtedgsira...dkvvlAaGawss----------------------
PF01266         lGveiiegtkVtglereggrvsgvrtedgsira...dkvvlAaGawss----------------------
PF02852         --------------------------------------------------------------alayaetk
PF02852         --------------------------------------------------------------alayaetk
PF03486         agvkirletevksvekeedgafrvkt.kseeele..adklvlAtGGk.SiPk------------------
PF03486         agvkirletevksvekeedgafrvkt.kseeele..adklvlAtGGk.SiPk------------------
PF03486         agvkirletevksvekeedgafrvkt.kseeele..adklvlAtGGk.SiPk------------------
PF03486         agvkirletevksvekeedgafrvkt.kseeele..adklvlAtGGk.SiPk------------------
PF00890         agkvdfqerhradeLivedgrvtGvvvenprsgrevrirakaavvla-----------------------
PF00890         agkvdfqerhradeLivedgrvtGvvvenprsgrevrirakaavvla-----------------------
PF00890         agkvdfqerhradeLivedgrvtGvvvenprsgrevrirakaavvla-----------------------
PF00890         agkvdfqerhradeLivedgrvtGvvvenprsgrevrirakaavvla-----------------------
PF02737         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
PF07992         lrlrek.pk..kvvvvGgGyigvelaaalakl......................................
PF00070         ----------rvvvvGgGyiGlElAaalaklgkkVtvierrdrllraldeeiakilqkklekngievlln
PF00070         ----------rvvvvGgGyiGlElAaalaklgkkVtvierrdrllraldeeiakilqkklekngievlln
PF00070         ----------rvvvvGgGyiGlElAaalaklgkkVtvierrdrllraldeeiakilqkklekngievlln
PF01266         -----------vviiGgGivGlstAyeLarrglkVtllekgd------------alaraaeelGveiieg
PF01266         -----------vviiGgGivGlstAyeLarrglkVtllekgd------------alaraaeelGveiieg
PF01266         -----------vviiGgGivGlstAyeLarrglkVtllekgd------------alaraaeelGveiieg
PF01266         -----------vviiGgGivGlstAyeLarrglkVtllekgd------------alaraaeelGveiieg
PF02852         gfvKlvvdaetgkvlGahivGpgaseliq-----------------------------------------
PF02852         gfvKlvvdaetgkvlGahivGpgaseliq-----------------------------------------
PF03486         -----------viviGgGaAGlmaAisaakrgakVllldkakkl---------dallkelkeagvkirle
PF03486         -----------viviGgGaAGlmaAisaakrgakVllldkakkl---------dallkelkeagvkirle
PF03486         -----------viviGgGaAGlmaAisaakrgakVllldkakkl---------dallkelkeagvkirle
PF03486         -----------viviGgGaAGlmaAisaakrgakVllldkakkl---------dallkelkeagvkirle
PF00890         ------------vViGsGlAGlaAAleaaeaglkvavveke-----------------------------
PF00890         ------------vViGsGlAGlaAAleaaeaglkvavveke-----------------------------
PF00890         ------------vViGsGlAGlaAAleaaeaglkvavveke-----------------------------
PF00890         ------------vViGsGlAGlaAAleaaeaglkvavveke-----------------------------
PF02737         -----------vaVvGaGtmGagiAavfaragleVvlvdiseealekalerieksleklvekgklk....


                         -         -         -         +         -         -         -:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
PF07992         ...................................tktllleklglelderGgivvdeylrTsvpgifAa
PF00070         tkveeiegsadgve.vkl----------------------------------------------------
PF00070         tkveeiegsadgve.vkl----------------------------------------------------
PF00070         tkveeiegsadgve.vkl----------------------------------------------------
PF01266         tkVtglereggrvsgvrtedgsiradkvvlAaGawssk.llkllgld-----------------------
PF01266         tkVtglereggrvsgvrtedgsiradkvvlAaGawssk.llkllgld-----------------------
PF01266         tkVtglereggrvsgvrtedgsiradkvvlAaGawssk.llkllgld-----------------------
PF01266         tkVtglereggrvsgvrtedgsiradkvvlAaGawssk.llkllgld-----------------------
PF02852         ----------------------------------------------------------------------
PF02852         ----------------------------------------------------------------------
PF03486         tevksvekeedgafrvktkseeeleadklvlA--------------------------------------
PF03486         tevksvekeedgafrvktkseeeleadklvlA--------------------------------------
PF03486         tevksvekeedgafrvktkseeeleadklvlA--------------------------------------
PF03486         tevksvekeedgafrvktkseeeleadklvlA--------------------------------------
PF00890         --------------------------------------------------gGvrtdenarvldadgqpip
PF00890         --------------------------------------------------gGvrtdenarvldadgqpip
PF00890         --------------------------------------------------gGvrtdenarvldadgqpip
PF00890         --------------------------------------------------gGvrtdenarvldadgqpip
PF02737         .eeeveevlarisvttdleeavdadlv-------------------------------------------


                         -         *         -         -         -         -         +:350
query           DVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
PF07992         GDva------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF02852         ------------------------------------------------vvftdpeiasvGlteeeAkkag
PF02852         ------------------------------------------------vvftdpeiasvGlteeeAkkag
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         GLYAaGev--------------------------------------------------------------
PF00890         GLYAaGev--------------------------------------------------------------
PF00890         GLYAaGev--------------------------------------------------------------
PF00890         GLYAaGev--------------------------------------------------------------
PF02737         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALRIDVLAALLHREGSVEDLLAL
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF02852         geikvgklpfkandralayae.tkgfvKlvvdaetgkvlGahivGpgase.liqelavaikagltve.dl
PF02852         geikvgklpfkandralayae.tkgfvKlvvdaetgkvlGahivGpgase.liqelavaikagltve.dl
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DLAYAPPFSPVWDPLLIAAQQAR-----------------------------------------------
PF07992         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF00070         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF01266         ----------------------------------------------------------------------
PF02852         antvfihPtls-----------------------------------------------------------
PF02852         antvfihPtls-----------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF03486         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF00890         ----------------------------------------------------------------------
PF02737         ----------------------------------------------------------------------