[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81963.1


[Show Plain Result]

## Summary of Sequence Search
   1::361
  18::263  PF00437 0.0% 31.7991631799163  Type II/IV secretion system protein 
 130::161  PF10412 0.0% 34.375  Type IV secretion-system coupling protein DNA-bindi 
 131::160  PF01935 0.0% 40  Domain of unknown function DUF87 
 128::179  PF06414 0.0% 20  Zeta toxin 
 120::149  PF01580 0.0% 36.6666666666667  FtsK/SpoIIIE family 
 130::161  PF03205 0.0% 37.5  Molybdopterin guanine dinucleotide synthesis protei 
   1::361


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEE
PF00437         -----------------kvsdihvnrpervwvervdglelreipelskaalerlisrvaalskqeisekr
PF10412         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF01580         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
PF00437         plldarlp...ekgerfrvvllPvveeeklviRkkssaslsledlaakgalkkklaevlrqavqargnil
PF10412         -----------------------------------------------------------ilivGttGtGK
PF01935         ------------------------------------------------------------AilgsTGsGK
PF06414         ---------------------------------------------------------kavllgGqpGAGK
PF01580         -------------------------------------------------lvadlvkaphlLiaGatgsGK
PF03205         -----------------------------------------------------------vlvvGpkdsGK


                         +         -         -         -         -         *         -:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
PF00437         vsGgTgSGKttllnallaeinkd.derivtiEDpvElqlegenqvqlnak..kakvtfadllraaLRqrP
PF10412         tqalrelldqirargdraiiy-------------------------------------------------
PF01935         SntvavLleellekkgatil--------------------------------------------------
PF06414         tslaellleelaagnivri..daDelrkyhpayrelekk-------------------------------
PF01580         StflrtLil-------------------------------------------------------------
PF03205         TTliekllnilkergyrvavv-------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DYETIAAAITAAETGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG
PF00437         DrilvGEiRdkealei.lrAvntGHlgslsTlHansaasalerLeqlgkelea-----------------
PF10412         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF01580         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFM
PF00437         ----------------------------------------------------------------------
PF10412         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF01580         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RLAGAPEGARR-----------------------------------------------------------
PF00437         ----------------------------------------------------------------------
PF10412         ----------------------------------------------------------------------
PF01935         ----------------------------------------------------------------------
PF06414         ----------------------------------------------------------------------
PF01580         ----------------------------------------------------------------------
PF03205         ----------------------------------------------------------------------