[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81982.1


[Show Plain Result]

## Summary of Sequence Search
   1::414
  40::259  PF08245 0.0% 30  Mur ligase middle domain 
   1::414


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDPLSWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSP
PF08245         ---------------------------------------iTGTnGKTTtteliaallkaagktvgtag..


                         -         -         *         -         -         -         -:140
query           HLVDFRERIQVQGRPIPEEKLLALLAELRPHAERLEASFFEAATALALLHFAREGVEFAVLEVGLGGRLD
PF08245         ........................................ntnneiglpallaeleekeadvavlElSsf


                         +         -         -         -         -         *         -:210
query           ATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEGLGVLRAEALARKTPLWVL
PF08245         glgekqlegl..lkpdiavitnitedHldyh.gtmenyaaaKsklfenlkekgiavvnadde...alaea


                         -         -         -         +         -         -         -:280
query           GEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQAENLALAALSGRLLGAGWEAVKRGVARAEN
PF08245         akkkkakvvtfgleeeadleaanlevseeggki..elvkvkgeeleikl---------------------


                         -         *         -         -         -         -         +:350
query           PGRLQRLLWRGRELLLDGAHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRY
PF08245         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ASLRSEDPRALLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRLEGLPAEERWQ------
PF08245         ----------------------------------------------------------------------