[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS81992.1


[Show Plain Result]

## Summary of Sequence Search
   1::220
  36::185  PF00174 0.0% 46.6666666666667  Oxidoreductase molybdopterin binding domain 
   1::220


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTWPAFSLGVWGYPEGMDPRVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLARP
PF00174         -----------------------------------hgavpevddeekwklevdGlverplslsledLkkl


                         -         -         *         -         -         -         -:140
query           QVELTRDFHCVTRWSRLDVTWKGVRTRDLLEEARPRPEAVAALVESYGGYTTNLLLEDLLREDVLLAHTL
PF00174         paeevtatlqCvgnrreglqwsagaignakWtGvpLadvLkeaglkpearhvvfegadeeeeeksgyaes


                         +         -         -         -         -         *         -:210
query           FGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRI
PF00174         iplekaldedvlLAyemngepLppdhGaPlRlvvpglygaksvKw-------------------------


                         -         -         -         +         -         -         -:280
query           RFAARNKPGR------------------------------------------------------------
PF00174         ----------------------------------------------------------------------