[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS82142.1


[Show Plain Result]

## Summary of Sequence Search
   1::285
  84::282  PF03466 0.0% 30.9644670050761  LysR substrate binding domain 
   4::59   PF00126 0.0% 58.9285714285714  Bacterial regulatory helix-turn-helix protein, lysR 
   1::285


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQALERELGVRLLERRPFRLTPAGDLLRREGARLL
PF03466         ----------------------------------------------------------------------
PF00126         ---rqLrlFvavaetgsftaAAerLglsqpavSrqikrLEeelgvpLfeRsgrglrlTe-----------


                         -         -         *         -         -         -         -:140
query           KELEALKEAVRRAGQEALRFGVPENLLPDLMPLLDHLRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAG
PF03466         -------------lrgrLrigapptlaayllppllarfraryPevelelvegdseelldllaegelDlai
PF00126         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEPFLLLPKDFLPPLYEAFMEVFRRAGFAP
PF03466         rrgppedpglearpLaeeplvlvappdhpLaarepvsledLadeplilleegsg..lrdlvedalaeagl
PF00126         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KVVREVARFSQAVSLVAAGLGVHLTLAPYRVYPHPGVVLRPLEEEAALEVALIYARRPPPPRLEEVRRLL
PF03466         kprvalevnsleallalvaaGlGiallprsavrdeladgrlvvlplpdpplprtlylvyrkgrelspavr
PF00126         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RALAL-----------------------------------------------------------------
PF03466         af--------------------------------------------------------------------
PF00126         ----------------------------------------------------------------------