[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS82156.1


[Show Plain Result]

## Summary of Sequence Search
   1::261
   8::254  PF02673 0.0% 45.0413223140496  Bacitracin resistance protein BacA 
  47::255  PF01925 0.0% 23.7113402061856  Sulfite exporter TauE/SafE 
   1::261


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGRVSAWEALLLGVVEGLTEFLPVSSTGHLTLLFHLLGLPVEEDPFLKTFLVAIQLGAILAVLLLYGRRL
PF02673         -------eaiilGivqGltEfLPvSStghlilvsallglee...degaafevviqlGtilAvlvyfrkdi
PF01925         ----------------------------------------------vatsllavlvtslvg.alahrrrg


                         -         -         *         -         -         -         -:140
query           AADRALWLRIAVAFVPTGVIGFFFYPLIKGVILGNDAVVAFFLFFVGAVLLFADRLAERAQYQDVKALPL
PF02673         lkllkgllrslakakkeearlllliivatipagvvGlllkdvikellfrslvlvaialivgGlllllaek
PF01925         nvdwrlllplllgallGallGalllsllpsell..kllfgvlllllallmllrkkraaekgrlrrpslil


                         +         -         -         -         -         *         -:210
query           ARVAWIGVFQGLAALFPGTSRSGATILGGLLLGLNRQAAAEFSFLLALPTMFAAVGYDLWKSAPEVPEGG
PF02673         lkkk.kkksleelslkdalliGlaQalA.liPGvSRSGaTitaglllglsreaAaefSFllaiPailgag
PF01925         llllgglvvGflsgllGig...gGvllvpllllllglplkkavatsllvflvislagllgy....vlg.y


                         -         -         -         +         -         -         -:280
query           WSLLLLGFLAALATALVTVRWMLAFVARHGFRPFALYRMALAAVYAFFFLR-------------------
PF02673         llellkllkaalsaeellallvgfvvafvvallaiklllrfvkk--------------------------
PF01925         vd...wpllllvllllpgallGallGarlarrlsert.lrrlfal-------------------------