[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS82166.1


[Show Plain Result]

## Summary of Sequence Search
   1::536
  30::104  PF00575 0.0% 38.3561643835616  S1 RNA binding domain 
 119::188  PF00575 0.0% 34.2857142857143  S1 RNA binding domain 
 206::277  PF00575 0.0% 48.6111111111111  S1 RNA binding domain 
 291::364  PF00575 0.0% 46.5753424657534  S1 RNA binding domain 
 378::450  PF00575 0.0% 45.2054794520548  S1 RNA binding domain 
   1::536


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEDKATQTPEQTFSMEAALQETEARLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
PF00575         -----------------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd..
PF00575         -----------------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd..
PF00575         -----------------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd..
PF00575         -----------------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd..
PF00575         -----------------------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd..


                         -         -         *         -         -         -         -:140
query           SEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKIEAQEKWDRIQELYEKGEPVTVTIKERVKGGVVAE
PF00575         rvedpeevlkvgdevevkvlkvdkerkriiLsik--------------pekGevvkGtVtsvtkgGafVd
PF00575         rvedpeevlkvgdevevkvlkvdkerkriiLsik--------------pekGevvkGtVtsvtkgGafVd
PF00575         rvedpeevlkvgdevevkvlkvdkerkriiLsik--------------pekGevvkGtVtsvtkgGafVd
PF00575         rvedpeevlkvgdevevkvlkvdkerkriiLsik--------------pekGevvkGtVtsvtkgGafVd
PF00575         rvedpeevlkvgdevevkvlkvdkerkriiLsik--------------pekGevvkGtVtsvtkgGafVd


                         +         -         -         -         -         *         -:210
query           LDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRKGRVILSRRAVLEEEQKKAREAFLKSLEPGQ
PF00575         lgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiL-----------------pekGe
PF00575         lgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiL-----------------pekGe
PF00575         lgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiL-----------------pekGe
PF00575         lgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiL-----------------pekGe
PF00575         lgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiL-----------------pekGe


                         -         -         -         +         -         -         -:280
query           VVEGTVVEVTDFGVFVNLGPVDGLVHRSEITWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALI
PF00575         vvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiLsi---
PF00575         vvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiLsi---
PF00575         vvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiLsi---
PF00575         vvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiLsi---
PF00575         vvkGtVtsvtkgGafVdlgngvegfipiseissdrvedpeevlkvgdevevkvlkvdkerkriiLsi---


                         -         *         -         -         -         -         +:350
query           PDPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVL
PF00575         ----------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd.rvedpeevlkvgdevevkvl
PF00575         ----------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd.rvedpeevlkvgdevevkvl
PF00575         ----------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd.rvedpeevlkvgdevevkvl
PF00575         ----------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd.rvedpeevlkvgdevevkvl
PF00575         ----------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissd.rvedpeevlkvgdevevkvl


                         -         -         -         -         *         -         -:420
query           RLDPEERRLSLGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
PF00575         kvdkerkriiLsik-------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrved
PF00575         kvdkerkriiLsik-------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrved
PF00575         kvdkerkriiLsik-------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrved
PF00575         kvdkerkriiLsik-------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrved
PF00575         kvdkerkriiLsik-------------pekGevvkGtVtsvtkgGafVdlgngvegfipiseissdrved


                         -         -         +         -         -         -         -:490
query           PAALFKKGDEMEVVVLNIDPVEQRVSLSRKRLLPPPLPQEEERPRRARSGKERARRKGAPRREDRREYEY
PF00575         peevlkvgdevevkvlkvdkerkriiLsik----------------------------------------
PF00575         peevlkvgdevevkvlkvdkerkriiLsik----------------------------------------
PF00575         peevlkvgdevevkvlkvdkerkriiLsik----------------------------------------
PF00575         peevlkvgdevevkvlkvdkerkriiLsik----------------------------------------
PF00575         peevlkvgdevevkvlkvdkerkriiLsik----------------------------------------


                         *         -         -         -         -         +         -:560
query           GAVAEYNLYDASSVPTTTATVKLGDLYGDLLASLGLEEEAEEKSRG------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------
PF00575         ----------------------------------------------------------------------