[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for tthe0:AAS82289.1


[Show Plain Result]

## Summary of Sequence Search
   1::223
  85::196  PF02391 0.0% 48.2142857142857  MoaE protein 
   5::79   PF02597 0.0% 52.0547945205479  ThiS family 
   1::223


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
PF02391         ----------------------------------------------------------------------
PF02597         ----vllfaelrelag..eeelelaegstvaelleaLgerypelaelerrvavavNgeivprlwldtelk


                         -         -         *         -         -         -         -:140
query           AFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMA
PF02391         --------------lekepisveevielvsereaGAivtFvGvvRdedegkeverleyeaypemaekele
PF02597         dgDevailp-------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGS
PF02391         eiveevkekfpvvrvavvHrlGelkigeaavliavsaaHRkeafealeylidelKk--------------
PF02597         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FWVEGFAPEDKRL---------------------------------------------------------
PF02391         ----------------------------------------------------------------------
PF02597         ----------------------------------------------------------------------