[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80359.1


[Show Plain Result]

## Summary of Sequence Search
   1::417
  10::412  3.2e-78 36.7% 0037070 00370701 1/1   lasmic binding protein-like II          
  37::409  3.5e-74 35.2% 0044496 00444961 1/1   lasmic binding protein-like II          
  30::410  4.2e-66 33.2% 0045538 00455381 1/1   lasmic binding protein-like II          
  34::392  4.9e-60 31.8% 0045575 00455751 1/1   lasmic binding protein-like II          
  32::414  1.5e-59 35.6% 0046627 00466271 1/1   lasmic binding protein-like II          
  31::412  3.9e-58 32.1% 0047899 00478991 1/1   lasmic binding protein-like II          
  32::412  2.3e-57 30.0% 0051191 00511911 1/1   lasmic binding protein-like II          
  33::381    8e-43 31.8% 0051197 00511971 1/1   lasmic binding protein-like II          
  33::381  1.2e-41 32.0% 0046289 00462891 1/1   lasmic binding protein-like II          
  31::387  1.1e-34 29.1% 0045745 00457451 1/1   lasmic binding protein-like II          
  33::385  1.6e-33 31.2% 0051251 00512511 1/1   lasmic binding protein-like II          
  31::383  3.1e-31 28.6% 0042407 00424071 1/1   lasmic binding protein-like II          
  31::383  7.2e-28 28.4% 0042594 00425941 1/1   lasmic binding protein-like II          
  33::380    2e-26 28.9% 0048393 00483931 1/1   lasmic binding protein-like II          
  29::378  4.6e-21 26.1% 0051126 00511261 1/1   lasmic binding protein-like II          
  33::378  5.9e-19 25.8% 0051127 00511271 1/1   lasmic binding protein-like II          
  30::384  3.7e-15 23.0% 0043543 00435431 1/1   lasmic binding protein-like II          
 131::335  3.7e-07 24.9% 0049726 00497261 1/1   lasmic binding protein-like II          
 303::337  0.00027 41.2% 0045817 00458171 1/1   lasmic binding protein-like II          
 240::338  0.00093 30.5% 0048733 00487331 1/1   lasmic binding protein-like II          
   1::417


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKALLLVAALGVAFAQQAKPEDVIKEQCARAKVVAEFWHGFTGGAPKAALENLVVEFNKAQQGRCVRPV
00370701   1/1  ---------aCg...................agvtltvwtwg.dgadlaalkelikeFeketpgikvkvv
00444961   1/1  ------------------------------------vtltvwhwl.gggegaalkelvaaFekehpdikV
00455381   1/1  -----------------------------aaaevtltvwt.wg.gyiaealkelikkFek.epgikVkvv
00455751   1/1  ---------------------------------vtltvwtwgddpdelealkelikeFekenpgikVelv
00466271   1/1  -------------------------------laggtltvytwgg.gyeaealeelikaFekenpgikvev
00478991   1/1  ------------------------------aaCgsssaekvtltvwswgt.gtqldalkelikefekenp
00511911   1/1  -------------------------------aCgssnssepvtltvwswgs.ptqadaleelvkkfeken
00511971   1/1  --------------------------------Gtltvyswggy......ealeelakaFeke.tgikvev
00462891   1/1  --------------------------------eltvytwggy......daleelakaFeke.tgikvevv
00457451   1/1  ------------------------------ektLtvyswggy.......llealikaFeket.gikVeyv
00512511   1/1  --------------------------------gtltvytwggy......daleelakaFeke.tgikvev
00424071   1/1  ------------------------------egtLtvyswggy.......llealikaFeketg.ikvkyv
00425941   1/1  ------------------------------egeltvytwgsl......ylleellkaFeke.tgikVevv
00483931   1/1  --------------------------------eLtvysagg......yealeelakaFeket.gikVevv
00511261   1/1  ----------------------------aaegeLtvytags......ydllkalldaFeke.tgikvevv
00511271   1/1  --------------------------------eLtvysags......ydllkalleaFek.etgikvevv
00435431   1/1  -----------------------------aagtLtvysasgltd.....alkelakaFekkykeetgtgi
00497261   1/1  ----------------------------------------------------------------------
00458171   1/1  ----------------------------------------------------------------------
00487331   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVRLQGVNLTFLNAVRFGGVVYG
00370701   1/1  tvg...dyeeklltalaagngpDvvvldadflaqlakaGllaplddllklpnlddflpalldaatvdGkl
00444961   1/1  kvvtvp.yddlltklltalaagnapDvvvvldgdwlgqlaaagllaplddllldlddflpaaldavtydg
00455381   1/1  ...pyddyeeklatalaggnapDvvqldgdwlgqlakagllaplddllkdlddflpalldaatydgklyg
00455751   1/1  vvpd........l.alaggsapDvvvldndwlaqlaeaGlllplddllakdlddflpaaldaatydGklY
00466271   1/1  vtlg.sddllaklallaalaagngqpDvvvldagdlaqlaeaGllaplddlladklpnlddllpalldla
00478991   1/1  gikvkivatvpwgdyeeklntalasgdlpDvvfidsgagwlaelakaGalvpLddlldkyapnlkelldd
00511911   1/1  pgikvefetlvpwddykqklntalasgdlpDvvfvdslsgllaqlakaGalldLddlidkyapnlkk.ll
00511971   1/1  vfgg.sgdllakllaalaagn.pDvvlsadadllaklaeaGllapld......ddflpalldaatvdgkl
00462891   1/1  t.ggsgellakllae.aggsppDvvlsadagllarlakaGllaplddllldpnlddllpalld.ld....
00457451   1/1  tfgsneellaklla...ggsgpDvvvldadflarlaeaGllepldksklpnldnlppalldalgttddgk
00512511   1/1  vtggsg..llakllae.aagsgpDvvlsadagllaklaeaGllaplddl....dflpalldaatdpdgkl
00424071   1/1  tggsgeellakllae..ggsgaDvvvvdayflarlakaGllepldpsklpnldnlppglrdpltddgkgy
00425941   1/1  tggs..gllakllaeg.ggsgaDvvlvadadllaklakaglleplds..sklpnl....lpaalddgngy
00483931   1/1  .tggsgellaklkae.gggapaDvvlsadadllarlakaGllaplds..pnldnlppnlr...dpdgkly
00511261   1/1  .fggsgellakllae.gggspaDvvlsadadllarlaeagllapld.......spnldnippelrdgdgy
00511271   1/1  .tggsgellakllae.gggspaDvvlsadadllarlaeagllapld.......spnldnlppelrdgdgy
00435431   1/1  kvey.vyggsgallakllagaqaDvvasadagdldrlakagllqpldp.kklp.................
00497261   1/1  ------------------------------------------------------------pvaydglvvv
00458171   1/1  ----------------------------------------------------------------------
00487331   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSRAEGGPVYWFQPDASTFAYFFFNLGGSYLKD
00370701   1/1  ygvPyavgttglyYnkdlfkk....pPktwdelleaakklkeklkgkvgladpggdwvflallaalGgdl
00444961   1/1  klygvPfdvstlvlyYnkdlfkk....pPkTwdelleaakklkakgkygyglggwdlvylflalllsagg
00455381   1/1  vPyavgtlglyYnkdlfkk....pPktwdelleaakklkakgkyglalggddgwlllalllslggdlfde
00455751   1/1  glPfaaetlllyYNkdll.....P.pktwdelleaakklkekgggglilkgkyglalpgkdgfglallfl
00466271   1/1  atvdGklygvPytvgtlvlyynkdllkkaGlpepPktwddlldaakklkekdglggpgvkglvalgdpsw
00478991   1/1  flpgllkavtydGkiYglPfaadvargrglfynkdllekaGldpPkTwdelleaakalkekdpngnGkkg
00511911   1/1  ddflpgaldavtvdGkiyglPyasdlavaqglfynkdlleklGlevPkTwdeleealkafkekdpdgnGk
00511971   1/1  ygvPyavgtlvlvynkdl....gldpkdpktwddlld..pklk....gkialgdp.gsglggallaalla
00462891   1/1  ..gvpyavgtlvlvynkdlfkkagl..PktwddLld..pklk....gkvalg.pssgtgglallallaal
00457451   1/1  lygvpytwgttglaynkdlfkeagldpeppkswddLld.pklkgklgvygialldppssglgaallalgg
00512511   1/1  yglpyg..tlvlvynkdlkfkk.....pk.wddLld..pklk....Gkialadp.tsglglallaallaa
00424071   1/1  gvpytvgttvlaynkdllkkag...pkswddLld..pklk....gkvalpdpassglgaallaaglslng
00425941   1/1  gvpyavgtlvlvynkdllkeagl..PkswddLldpklk......gkvalldptsgyglallaaglslyge
00483931   1/1  gvplavgtlvlvynkdllkeagl..PkswedLldpklk......gkialadpsssgtgllaa.llaalgg
00511261   1/1  wvplalgalvlvynkdllkeagl..PkswddLldpelkgkialadp...sgtglallaallqalGe....
00511271   1/1  wvplavgalvlvynkdllkeagl..PkswadLldpklk......gkialadp.sgtglalllallgllge
00435431   1/1  ........yavplatgtlvlivnkdnpkk.....ikswddLlk........pgvkvvlpdpktsgtgrla
00497261   1/1  vppgnp..vlvlnkdqlakiflgkitswkdLa......kpdlkikvvlrdpgsgtrglflaallag....
00458171   1/1  ----------------------------------------------------------------------
00487331   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GKLVLNSKEAVEALTLLQNGVKEGWAKPITSGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLP
00370701   1/1  fdedggkltfnspeavkaleflkdlvknglapgfdsdealalfasGkaamaisgswaaallkd.agfdlg
00444961   1/1  dlfddgkvtldspeavealeflkdlvkkglappagldwdealalfasGkaamvisgpwalgalkka.gfd
00455381   1/1  dgtdllsgkltfnspeavkaleflkdlvknglvppgadwdealalfasGkaamaingswaaallkkp.gf
00455751   1/1  pllasaggdlfdedgtgkltfdspeavealeflkdlvkkglappgalsfgesealdlFasGkaamviggp
00466271   1/1  sgtylllaallalggdlfdedggdleltlnspeavkaleflkklvknvgyvppgaltadsdealqglfas
00478991   1/1  vygfalggkdgwgllllfegflllllgaggdfldkdgklvptfndpeakealeflkelykeGlippdaat
00511911   1/1  kdvyplalggkdgwtltlaflslllalggpgglfvdedgkvvygfddpeakealeflkklykeGlippda
00511971   1/1  alg..........avkaleflkklkknglvppsggwgealqlfasGeaamgivgswalgrlwlsdaaaaa
00462891   1/1  gg...........vkaleflkklkkngavvp.ggsealqlfasGeaamgisgsgaaallkaegkklggkv
00457451   1/1  slndld....tdeeldkalellkelkpnv..laftsgealqllasGevamavawsgdaaaaladaeeaaa
00512511   1/1  ng..........avkaleflkklkkngavpvtg.gggealqlfasGeaamgisgswylgllldssaaaal
00424071   1/1  .....lnpeelekaleflkklkpnvavfp..sgevlqllasGevavaisw.sgdaalakkegakvgvvip
00425941   1/1  d...........kalellkklkpnvvvvtkggssqalqlfasGevaigivysgdaaaakleldakeakag
00483931   1/1  d...........kalellkklkkng.vvtksvsaalqavasGeaaaglvysgdaaalkkelgalganvgv
00511261   1/1  ...........ekalellkklkknga..vtgsgsdvlkavasGevaigivysyyaaalkadakelgapvg
00511271   1/1  e...........kalellkklkpnlv..vtgsgsevldavasGevaigivysgdaaalkaeegklgapvg
00435431   1/1  llallaaglsk.....dkgdeekaleflkklkknvvvlassgvgavlaavasGeadvgivwegyallakk
00497261   1/1  ..........ldlalellkglkpnvvvlgsngavlqavasgegaigyvslsya..laalkgvkleivvps
00458171   1/1  ----------------------------------------------------------------------
00487331   1/1  -----------------------------gnggvvqaVastpgaiGy...vglsylleanqdklkvlall


                         -         *         -         -         -         -         +:350
query           GRTKGQPGYGLVQGTNLVVFRQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYA
00370701   1/1  vaplPkgpggkggllegsllggdglaipkgsk..nkeaAkkfinfllspevqakllaeatgylparksal
00444961   1/1  lgvaplPagpggpkrgtflggdglaisk..gsknkeaAwkflkfltspeaqaklaeatgylPvrksaled
00455381   1/1  dlgvaplPald.ggkegtllggdglavpkgsk..nkeaAkkflklfltspevqaklaeetgylPvrkaal
00455751   1/1  walallkda.ggkigvaplPagp.gkeg.tllggdglaiskgsk..hkeaAlkFikfltspevqallale
00466271   1/1  GeaamaiggswaaallkaagpevagdvgvaplPagpgg.kegtllggdglaipkgsk..npeaAkkflnf
00478991   1/1  ld.ddalelfasGkaamlidgswaiglladalpldnvpgfklgvaplpkgpdgkglvllratvlggdgla
00511911   1/1  ltldyddavelfasGkaamyiggswaigalldalpdnnpgakvgvaplpagpggkkltlvgasslggdgl
00511971   1/1  vkglkvgvv.lP...kegkrgtllggdglaipkgak..npeaAkaFldfllspegqailakaggylpvnk
00462891   1/1  gvvppp....egprgtllggdglaipkgsk..npeaAkkFldfllspeaqailaeaggylpvnksalldp
00457451   1/1  gakvgvvipp.......eGtllwvdglaipkgak..nkeaAkkFinfllspeaqallaeatgylpvnkda
00512511   1/1  keagdkvgvvppPagpgg.kegtllggdglaipkgsk..npeaAkkFldfllspeaqailaeaggylpvn
00424071   1/1  p......eG.tllwvdglaipkgakn..peaAkkFinfllspeaqallaeaggylpvnkdaaa..llspe
00425941   1/1  anvgvvvpp......eG.tllnvdglailkgaknp..eaAkkFidfllspeaqailaeyggylpvnkgvl
00483931   1/1  vvpp....ekdlgtlvgvdgaailkgak..npeaAkkFidfllspeaqailaeaggyipvnkdvlldpel
00511261   1/1  vvipp....egdrgtvvgvsgaailkga..knpeaAkkFidfllspegqailaeaglgelpvnkdvalpp
00511271   1/1  vvfpp....egdlgtlvnvdgaailkgak..npeaAkkFidfllspeaqailaeaglgeyPvnpdvalpp
00435431   1/1  elggdklevvipkegtlawpdvayvlavv......kdaknkeaakaFldfllspegqeilak.ygyrPvn
00497261   1/1  eetlaegsypinrply.ivkkaknpeal..akaFldfllspegqkilaey.gyvl---------------
00458171   1/1  ----------------------kgaknkeaAkaFldfllspeaqailaky.gfippv-------------
00487331   1/1  nk.dgkfvlptleniaaalagadiklgndlalvllnppgsgsYPlsrplyiyvnkkyk------------


                         -         -         -         -         *         -         -:420
query           AENPDYATIVRQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSRTR---
00370701   1/1  ldpelke....dpllkafaealkkavplpslpnypev.sdalgdalqaallgkktadpeeal--------
00444961   1/1  p....llakdpllkafleqlknavprpnipeypavsdala..alqavllgkkspeealk-----------
00455381   1/1  edp.....lkkdpllkaflealekavpvpnipeypevw.dalgealqaallgkkspeeal----------
00455751   1/1  ggllnvpvlylParksaledpev.....kdplaaallealed----------------------------
00466271   1/1  llspeaqallaeatgylpvnksaledpelae...adpalaallealknavplpslpeypevr.d------
00478991   1/1  iskns..knpeaAlkfldfltspegqkllayGieGvhyekedgalpvrksvledpeflkaaa--------
00511911   1/1  aiskns..knpeaalkfldfltspegqkllayGieGvhYtkedgklpvrksvledpdflkal--------
00511971   1/1  dalldpelaalppikpdtldlavlapnrp..---------------------------------------
00462891   1/1  elkalpplkpda...ldllkladlrpalpll---------------------------------------
00457451   1/1  aelldpelaanpalyppaevl...kllepdpplvaev---------------------------------
00512511   1/1  ksalldpelkalppikpdal......dlaelaplr-----------------------------------
00424071   1/1  vkkdpllkpdaealakllvlpdlgewaelrdel-------------------------------------
00425941   1/1  lppevknlpalkpd......lldlavlapnrpe-------------------------------------
00483931   1/1  kallei...kpilldlselaelrealelwn----------------------------------------
00511261   1/1  alaalpel...kpitldlaelaenrlda------------------------------------------
00511271   1/1  alakllel...kpipldlaelaenreka------------------------------------------
00435431   1/1  kdvl..akllaklkplkliapdldflgwlevlkd------------------------------------
00497261   1/1  ----------------------------------------------------------------------
00458171   1/1  ----------------------------------------------------------------------
00487331   1/1  ----------------------------------------------------------------------