[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80360.1


[Show Plain Result]

## Summary of Sequence Search
   1::620
 213::616   2e-104 41.5% 0035140 00351401 1/1   yde ferredoxin oxidoreductase, C-termin 
 215::620 2.7e-101 41.8% 0035314 00353141 1/1   yde ferredoxin oxidoreductase, C-termin 
   2::210  1.7e-69 52.6% 0035141 00351411 1/1   yde ferredoxin oxidoreductase, N-termin 
   2::212  3.6e-65 52.9% 0035315 00353151 1/1   yde ferredoxin oxidoreductase, N-termin 
   1::620


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPKGYHDRVAFVDLSTGKVWYESFGEAFWRRYLGGRALAAYLLLRHVPKGADPLGPENALVFAPGILTGT
00351401   1/1  ----------------------------------------------------------------------
00353141   1/1  ----------------------------------------------------------------------
00351411   1/1  -llgyagkilrvdlstgkveveeldeellrkylGgrglglkllldevdpdvdPlspenklvfatGpltGt
00353151   1/1  -llgyagkilrvdlstgkveveeldeellrkylGgrglglkllldev.pevdPlspenklvfatGpltGt


                         -         -         *         -         -         -         -:140
query           PISGSGRNTVAAKSPLTGGYGDAEGGGFFGAELKNAGLDALVVLGQAEAPVYLHVEGGKVALHPAVHLWG
00351401   1/1  ----------------------------------------------------------------------
00353141   1/1  ----------------------------------------------------------------------
00351411   1/1  laplsgrlvvvaksPltgtlgesnaGGlfaaalkraGydalvieGkaekpvylvieddgvelldaselwg
00353151   1/1  laplsgrlvvvaksPltgtlgesnaGGlfaaalkraGydalvieGkaeepvylvieddgvelldaselwg


                         +         -         -         -         -         *         -:210
query           KDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDLAHFAGRGGLGAVMGAKRLKAVSARAHKETL
00351401   1/1  ----------------------------------------------------------------------
00353141   1/1  ----------------------------------------------------------------------
00351411   1/1  lgvletlealleelgdkkasvaviGpAGenlvllAlivvdllraagrgGlGavmgsknlkaivvrgdkgv
00353151   1/1  lgvletteallellgkkasvaviGpAGenlvllAlivvdllraagrgGlGavmgsknlkaivvrgdkgve


                         -         -         -         +         -         -         -:280
query           PAYHDPGLLKELARRMAKERMDRAAGLVTMGTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALG
00351401   1/1  --vadpekfkelvkeilklikespvtyeglrtyGTavlvnvlnelgalPtrnfregyfeeaekisgeel.
00353141   1/1  ----dpeefkelvkeilkliksspvleglatyGTavlvnvlnelgalPtrnfregyfeeaekisgeal..
00351411   1/1  ----------------------------------------------------------------------
00353151   1/1  la--------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IRIGRDTCYACAIRCKQVVKIEGTGKYDVRPEYGGPEYEGLGALGSTCGVTDPYAVTKANTLCNQYGLDV
00351401   1/1  aekylvrrigCagCpigCgklvkvkegky......tvgpeyetiaalGanlgitdldavlklndladelG
00353141   1/1  ekylvrligCagCpigCgrlvrvkegky.......vgpeyetiaalGsllgitdldavlklndladelGl
00351411   1/1  ----------------------------------------------------------------------
00353151   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           IGVGVTIACAMEAVEKGYLDDEGLGLRFGNGDALIAAIEKLARREGRLGELLAQGAKRLAESLGHPELAM
00351401   1/1  lDtistGnvlAwamellekGllkeeelggllklefgdaeallellekiayreg.lgdiLAeGvrraaekl
00353141   1/1  DtistGnvlAwamelyekGllk...eelsfgdaeallellekiayregelgdiLAeGvyraaeklgledl
00351411   1/1  ----------------------------------------------------------------------
00353151   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPLPIEDLSEAKI
00351401   1/1  gaedlavyvkglelpaydpralkgialgyatsarggdHlrgya.........valellgvplavdplslp
00353141   1/1  amgvkglelpaydprglkglglayatsnrGadhlr..gyaalleilgvplkldplglvakdlfld..peg
00351411   1/1  ----------------------------------------------------------------------
00353151   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVGERTLQLTRLFNLREGISPEE
00351401   1/1  ...egkaklvillelltalldslglClfarfalglellaellsavtGidlspeelleiGerilnlerafn
00353141   1/1  kaklvkllelltalldslglClfarfaltlplellaellsavtGielspeelleigerilnlerafnlra
00351411   1/1  ----------------------------------------------------------------------
00353151   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           DRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEGGVDPERLRALGLEEFQNALA----------
00351401   1/1  lraGftpreddtlPerfleepleegpakg.dvedleelleeYyelrGwdeeGvPtp--------------
00353141   1/1  glgefrreddtlPerffeeplpegpakgvvldredleelleeYyelrGwdeeGvPtpetl----------
00351411   1/1  ----------------------------------------------------------------------
00353151   1/1  ----------------------------------------------------------------------