[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80391.1


[Show Plain Result]

## Summary of Sequence Search
   1::397
   1::391 6.8e-107 37.4% 0038952 00389521 1/1   ependent transferases                   
   2::393 6.3e-105 38.6% 0050768 00507681 1/1   ependent transferases                   
   8::391 2.9e-103 38.3% 0050390 00503901 1/1   ependent transferases                   
   4::393 2.5e-101 37.5% 0050696 00506961 1/1   ependent transferases                   
   1::391 1.4e-100 38.9% 0035401 00354011 1/1   ependent transferases                   
   7::393    5e-97 37.4% 0051323 00513231 1/1   ependent transferases                   
   4::395  1.7e-92 33.9% 0050261 00502611 1/1   ependent transferases                   
   7::395  4.4e-92 37.1% 0046024 00460241 1/1   ependent transferases                   
   7::393  5.4e-90 38.1% 0050977 00509771 1/1   ependent transferases                   
   8::390  1.5e-89 38.4% 0044595 00445951 1/1   ependent transferases                   
   8::391  7.8e-89 35.4% 0039341 00393411 1/1   ependent transferases                   
   9::391  2.5e-88 38.3% 0046965 00469651 1/1   ependent transferases                   
  21::395  4.5e-88 36.1% 0052862 00528621 1/1   ependent transferases                   
  10::384  5.2e-88 37.5% 0045171 00451711 1/1   ependent transferases                   
   7::394  3.7e-87 36.6% 0046089 00460891 1/1   ependent transferases                   
  31::391  2.4e-86 38.5% 0037569 00375691 1/1   ependent transferases                   
  10::391    2e-84 34.8% 0041674 00416741 1/1   ependent transferases                   
   1::390  3.2e-83 34.4% 0035589 00355891 1/1   ependent transferases                   
  10::387  7.2e-81 35.6% 0053335 00533351 1/1   ependent transferases                   
  16::390    3e-80 35.7% 0047956 00479561 1/1   ependent transferases                   
   7::389  5.6e-79 35.2% 0049754 00497541 1/1   ependent transferases                   
  37::394  4.9e-78 35.5% 0046255 00462551 1/1   ependent transferases                   
   8::384    8e-78 32.6% 0045639 00456391 1/1   ependent transferases                   
   3::387  2.7e-77 31.3% 0045068 00450681 1/1   ependent transferases                   
  10::387  6.7e-75 32.3% 0045231 00452311 1/1   ependent transferases                   
  10::386  3.8e-74 35.0% 0042806 00428061 1/1   ependent transferases                   
   6::387  1.3e-73 32.2% 0035073 00350731 1/1   ependent transferases                   
  19::386  2.3e-62 32.4% 0044523 00445231 1/1   ependent transferases                   
  15::391  3.4e-57 29.4% 0044807 00448071 1/1   ependent transferases                   
  34::391  1.1e-56 32.8% 0050157 00501571 1/1   ependent transferases                   
  13::390  4.2e-55 30.7% 0046165 00461651 1/1   ependent transferases                   
  45::393  6.4e-49 29.6% 0048952 00489521 1/1   ependent transferases                   
  51::393  7.8e-49 29.5% 0048571 00485711 1/1   ependent transferases                   
  50::391  5.9e-48 29.2% 0041704 00417041 1/1   ependent transferases                   
  30::393  1.4e-46 32.0% 0040526 00405261 1/1   ependent transferases                   
  25::391  1.3e-45 29.2% 0051195 00511951 1/1   ependent transferases                   
  34::393  1.8e-45 27.4% 0047441 00474411 1/1   ependent transferases                   
  29::391  2.4e-44 30.3% 0038034 00380341 1/1   ependent transferases                   
  32::393  1.6e-42 25.5% 0046747 00467471 1/1   ependent transferases                   
  13::393  2.2e-42 27.5% 0050754 00507541 1/1   ependent transferases                   
  56::391  1.9e-41 25.3% 0044083 00440831 1/1   ependent transferases                   
  49::393  4.6e-41 24.2% 0045392 00453921 1/1   ependent transferases                   
  12::391  1.2e-40 25.7% 0036406 00364061 1/1   ependent transferases                   
   5::390  3.6e-40 24.3% 0052070 00520701 1/1   ependent transferases                   
  19::393  4.6e-40 26.0% 0035846 00358461 1/1   ependent transferases                   
  33::393  5.3e-40 26.3% 0046547 00465471 1/1   ependent transferases                   
  17::391  4.5e-39 25.3% 0036780 00367801 1/1   ependent transferases                   
  79::395  1.8e-38 30.7% 0048747 00487471 1/1   ependent transferases                   
  35::390  2.9e-38 25.1% 0046007 00460071 1/1   ependent transferases                   
  32::393  7.7e-38 27.4% 0042144 00421441 1/1   ependent transferases                   
  34::388    1e-37 27.2% 0049486 00494861 1/1   ependent transferases                   
  13::391    2e-37 25.3% 0051757 00517571 1/1   ependent transferases                   
  23::388  3.5e-37 28.3% 0041260 00412601 1/1   ependent transferases                   
  46::393  6.4e-37 27.0% 0048074 00480741 1/1   ependent transferases                   
  39::391  1.7e-36 27.3% 0040897 00408971 1/1   ependent transferases                   
  47::391  1.9e-36 24.5% 0040134 00401341 1/1   ependent transferases                   
  49::393  1.2e-35 23.5% 0042809 00428091 1/1   ependent transferases                   
  38::396  1.5e-35 24.0% 0046206 00462061 1/1   ependent transferases                   
  16::393  5.1e-35 27.1% 0052164 00521641 1/1   ependent transferases                   
  28::391  3.2e-34 26.3% 0047340 00473401 1/1   ependent transferases                   
  14::393  1.2e-33 25.6% 0047095 00470951 1/1   ependent transferases                   
  31::393  1.9e-32 26.4% 0035700 00357001 1/1   ependent transferases                   
  51::390    2e-31 26.7% 0050753 00507531 1/1   ependent transferases                   
  27::389  2.4e-31 26.5% 0046584 00465841 1/1   ependent transferases                   
  70::391  1.3e-28 26.5% 0035246 00352461 1/1   ependent transferases                   
  47::391  3.4e-28 27.6% 0052302 00523021 1/1   ependent transferases                   
  70::391  2.4e-27 25.9% 0046087 00460871 1/1   ependent transferases                   
  17::391  9.4e-26 25.8% 0046056 00460561 1/1   ependent transferases                   
  43::396  1.6e-24 24.6% 0045973 00459731 1/1   ependent transferases                   
  50::395  2.8e-24 21.7% 0043583 00435831 1/1   ependent transferases                   
  31::390    2e-23 24.4% 0050076 00500761 1/1   ependent transferases                   
  50::393  7.5e-22 24.5% 0052943 00529431 1/1   ependent transferases                   
  50::393  3.5e-21 26.0% 0052157 00521571 1/1   ependent transferases                   
  42::391  4.1e-21 24.5% 0049070 00490701 1/1   ependent transferases                   
  43::398  1.2e-20 25.6% 0049524 00495241 1/1   ependent transferases                   
  50::394  1.5e-20 25.0% 0051601 00516011 1/1   ependent transferases                   
  79::395  3.7e-16 25.7% 0047670 00476701 1/1   ependent transferases                   
  36::393    5e-15 23.8% 0035586 00355861 1/1   ependent transferases                   
  47::395  1.5e-14 20.2% 0046154 00461541 1/1   ependent transferases                   
  17::393  1.2e-13 20.6% 0042383 00423831 1/1   ependent transferases                   
  49::357    1e-10 24.1% 0045909 00459091 1/1   ependent transferases                   
  34::394  3.6e-08 23.1% 0047581 00475811 1/1   ependent transferases                   
  42::393  7.5e-07 26.4% 0050340 00503401 1/1   ependent transferases                   
  39::205  1.6e-05 18.4% 0052731 00527311 1/1   ependent transferases                   
  73::397   0.0005 25.1% 0051993 00519931 1/1   ependent transferases                   
   1::397


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKGEVALQY
00389521   1/1  ms.sflstllsprlkslkpyvigellelaaelgaggpdvidlgigepdlgtpplelllltlvlpavleal
00507681   1/1  -llldlslllsdrllglppsvirkllelaagpdvidlgigepdlppppleavrealaealdelglgllgY
00503901   1/1  -------mllserldrlgpsvidellelaggpdvidlgigepd..lppppevlealaealds.galllry
00506961   1/1  ---pgsgtfvsdrlpdlppspirellelaggpdvidlgigepdlgppplpaviealaealdsggalllgy
00354011   1/1  Ms.sflklllssrlkslkpsvilellelaaelgangpdvidlgvgepdfgpplldllgltlplpavleal
00513231   1/1  ------klllskrldrlgpspirallllaagpdvidlgigepd..fppppavlealaealdeggalllgY
00502611   1/1  ---lsslplsllldlnlslssrlplvpldlirelladadgpdvidlgsgepdlglgpppavlealaeala
00460241   1/1  ------mmdlssrlerlppsvirkllelaardaggpdvidlgigep..dfppppavlealaealdelldg
00509771   1/1  ------smdlserlsrl.psyireilelaaelgadgkdvidlgvgepdlldfppppavlealaealddg.
00445951   1/1  -------lelssrldglpaslirellelaggpdvidlgvgep..dlpppeavlealaeal....ggllgy
00393411   1/1  -------mllssrlrnlkpyvigpilelaaelgadgpdvidlgvgep.d.lppppavlealaealesg..
00469651   1/1  --------llskrlerlppspilellellaggpdvidlgvgep.d.lppppavlealaealdsg...llg
00528621   1/1  --------------------ladrlknlppsitlallalalellaggkdvidlsvgep..dfppppavle
00451711   1/1  ---------lfsrlkalppdpilallalaaedpgpdvidlgvgvyldlepdlppppavlealaealed..
00460891   1/1  ------mmllsdrlldlkpsvilkllalaaelgaggpdvidlgigep..dfppppavlealaealdeg..
00375691   1/1  ------------------------------gpdvinlgigdpdfplppavlealalaelidldanenplg
00416741   1/1  ---------issrllnlppyvfdeilelaalldadgpdvidlgvgep.d.lppppavlealaealesg..
00355891   1/1  Ms.llssrllglkpslvleilelaalldadgkdvidlgagepd..lppppavlealaealdsg...llgy
00533351   1/1  ---------lfkrlgrlppspirgllalladldgkdvidlgvgiyldpepdlppppavlealaealdd.g
00479561   1/1  ---------------llppspilsllelaaelgaggkdvidlsvgep..dfppppavlealaealdg...
00497541   1/1  ------nmllserldrlppsailelleladgpdvidlgsgep..dlppppavlealaealdn...gllgy
00462551   1/1  ------------------------------------vidlsvgepdfppppavlealaeald....gllg
00456391   1/1  -------mslfsrlkalppspilellelakelpgpdvinlgigvyrdeepdlptppavkealkealee..
00450681   1/1  --mlsllsnlkplppdpilglleaakad.pgpdvinLgigvyrdeepdlppppavkealaealedgll.l
00452311   1/1  ---------lnsllsslppyppdpilglaaalkadgrpdvinlgigvyrdeepdlppppavrealaeale
00428061   1/1  ---------lfsrlkalppspilklleaakrlggpdvidLgvgvyldlepdlppppavlealaealee..
00350731   1/1  -----lmlslfsrlealppdpilglleaakkdpgpdkinlgiGvyrdeepdlpvppavkealaealedl.
00445231   1/1  ------------------llellaaellaggpdvidlsvgep..dfppppavlealaealddg...vlgy
00448071   1/1  --------------plvllrairsllpd..gdgviyldsagp...gplppavlealaeall.gh...lsy
00501571   1/1  ---------------------------------leellelleslllsllyrlplvivraegayltdvdgr
00461651   1/1  ------------kldtllvhagrlldlgtggidliilstgeppfpvpe..avlealaealasghl..ygy
00489521   1/1  --------------------------------------------mdlsklldrletlalhagllpdvlla
00485711   1/1  --------------------------------------------------lelslpllltelpglssell
00417041   1/1  -------------------------------------------------Pevlealaevlesg....wly
00405261   1/1  -----------------------------mslttlrvaelakrlanlvpsgilrvladelkaegkdiikl
00511951   1/1  ------------------------llkrllkldtlairagfpllartggvivldlsagtppfpvpeavle
00474411   1/1  ---------------------------------iyldgpgptplppevlealarall........shrsy
00380341   1/1  ----------------------------llalgtdvihlgsgepdylgpvappiylsstftfevleavie
00467471   1/1  -------------------------------lllllllllllldeelllllaeelyrlplvivrgegarl
00507541   1/1  ------------ryippteeeiaemldaigvssldelfdpipleirrgeglplpdlserevldelsglas
00440831   1/1  -------------------------------------------------------lgslpepevgaqgep
00453921   1/1  ------------------------------------------------ptprskellerakklllggyts
00364061   1/1  -----------lnpalsetellrelldl.asnnylglasvillgasttpvppavleallealenkygegy
00520701   1/1  ----llldsleelldelipeglrrpfplllglplvlvralgrlldvdgkeyldlasnnylg.lhtppavl
00358461   1/1  ------------------pplfdalvklaeegpysfhvpghkggvlnfasnlylgfpdfpgpnealealg
00465471   1/1  --------------------------------dliyldnaap...tplppevleamaealeklygnpssg
00367801   1/1  ----------------kdlsletlaihagsgpdvlnl.vgppiyltnefvfelpeavlealaegltgyty
00487471   1/1  ----------------------------------------------------------------------
00460071   1/1  ----------------------------------dlldlldelleelkpeglyrplpivkgegarlidvd
00421441   1/1  -------------------------------kgviyldsaat...tpvppevlealaealeslllfgnph
00494861   1/1  ---------------------------------liyldsdattpp...ppavlealaealev...gdgny
00517571   1/1  ------------elirketlrlrgginasenvlslnvlgaqtspevieaaeeal.........ggygysr
00412601   1/1  ----------------------ealellalgtdvihlgsnenp..lgavappiyqtptfvldalaeald.
00480741   1/1  ---------------------------------------------iyldnagptplppavlealleglg.
00408971   1/1  --------------------------------------iplplgepdfpeevleaviealdsgg.....y
00401341   1/1  ----------------------------------------------miplgsetrklldlisndylglae
00428091   1/1  ------------------------------------------------mpkslelldraklllpggvnsy
00462061   1/1  -------------------------------------rqvggivlilsenappfyvpeavldalteayae
00521641   1/1  ---------------lrllfpirelfpllmdliyldnagptplp.....pevleamleal....ishrsp
00473401   1/1  ---------------------------ealgkdliyl..gsgapglgtppvvraaaeaaadlfanplsgg
00470951   1/1  -------------llllllfpllllfpllkgliyLdnagptplppevleamleal.........ihhlgp
00357001   1/1  ------------------------------kplvylfs...aGPaplppevleamlkelldllgnglsvl
00507531   1/1  --------------------------------------------------avieallealegltaytpyq
00465841   1/1  --------------------------efpllkgliyLdnaalgllppavleamaealeelagngssghrl
00352461   1/1  ---------------------------------------------------------------------r
00523021   1/1  ----------------------------------------------mkfetlllhagldpdpltgavnpp
00460871   1/1  ---------------------------------------------------------------------l
00460561   1/1  ----------------lelellRelfplldlnllldgliyldnaattplppavleamaealeeyygnphs
00459731   1/1  ------------------------------------------dkllsellelllaagllrldpeifsalr
00435831   1/1  -------------------------------------------------geldlpglvhpftralslygp
00500761   1/1  ------------------------------gtehidflsdnptgph...pavlealaeallg...ddlgy
00529431   1/1  -------------------------------------------------pevvealkeqldrlghvs...
00521571   1/1  -------------------------------------------------pevvealkeqldklghvs...
00490701   1/1  -----------------------------------------lllelalaldelellealrklfpllkgli
00495241   1/1  ------------------------------------------lldlldirllfpalslfalgkdliyldn
00516011   1/1  -------------------------------------------------msskelipgdlnsllrpftgl
00476701   1/1  ----------------------------------------------------------------------
00355861   1/1  -----------------------------------kvylfsaGPaplppevleaaakellnyqgngasvl
00461541   1/1  ----------------------------------------------lselllllleglyevdpeiaelie
00423831   1/1  ----------------llkivdllnekvldvlgsevldellpkyelPeeglsleevlellkdllsldgnp
00459091   1/1  ------------------------------------------------ksdliPdfptipeeeieavaea
00475811   1/1  ---------------------------------midlrsdtvtp...ptpevleamaeanvgdd....vy
00503401   1/1  -----------------------------------------aGPaalppev.lealaeellnyngvgrsv
00527311   1/1  --------------------------------------kkiplgspvfdeeeiaavlealdsg.....vy
00519931   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFL
00389521   1/1  aealdgllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllralldpGdevlvpd
00507681   1/1  pdpaGlpelreaiaeylarrrgvpdpeqilvtnGatealalllralldpGdevlvpsptYpgylaaarla
00503901   1/1  pdpaglpelreaiaellgrrygvdvdpeeeilvtnGgtealelalralldpGdevlvpdptYpgylaaar
00506961   1/1  gdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalrallgpGdevlvpsptYpaylaaarl
00354011   1/1  aealaeg...llgYpdpaGlpelreaiaellarrygllvgvdpeeilvtnGatealelalralldpGdev
00513231   1/1  pdpaGlpelreaiaeylarrygvgvdpeeeilvtnGatealalllralldpGdevlvpsptYpgylaalr
00502611   1/1  elgpgllgygppeglpelrealaellaelfgaeaadpeeivltnggteAlelalrallgpGdevlvpdpt
00460241   1/1  agllgYpdpqGlpelreaiaellgrrygvdvdpallkledeivvtnGgtealllalralldpGdevlvpd
00509771   1/1  ..llgYpdpaGlpelreaiaellkrrrgvgvdpeqilvtnGatealalllralldpgdevlvpdptYpgy
00445951   1/1  pdppglpelreaiaallgvdpeeivvtsGatealnlalrallgpGdevlvpsptypaylaalrllGakvv
00393411   1/1  .llgygpspglpelrealaellgarygvavdpeeivvtnggtealllallallgpGdevlvpdptypayl
00469651   1/1  ygppaglpelreaiaeyllrrrgvgvdpeteilvtnGatealalalrallgpGdevlvpsptypayaaaa
00528621   1/1  alaeald....gllgypppaglpelreaiaeylerrygvgvdpenilvtnGatealflalrallnpGDev
00451711   1/1  gltlgYgppeglpelreaiaellarygvgvdpeevvvtnGgtealalalrllallnpgdevlvpdptypg
00460891   1/1  .llgYpp..glpelreaiaeylkrrygvgvdpdeilvtnGatealflllrallnpGdevlvptPtYpgyl
00375691   1/1  pslaaldagllrypdp.glpelreaiaellgvdpeeilvtnGatealalllrallnpgdelvlvpdptYp
00416741   1/1  .llrygdptglpelreaiaellgrrrgvavdpeevvvtnggtealelalrallgpGdevlvpsptypgyl
00355891   1/1  gpppglpelrealaellgarygvavdpeeivvtnggtealelalrallgpGdevivpsptypgylaaarl
00533351   1/1  agllgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealelalralrklgpgdevivpspt
00479561   1/1  .llrypdp.glpelreaiaallgvdpeeilvtnGatealalllral..pgdevlvptptYpgylaaarla
00497541   1/1  ppsqglpelrealaellaellgadldpetevlltsggtealelalrallgpgdevlvpdptypgylaaar
00462551   1/1  yypsaglpelreaiaeylkrrygvgvdpdnilvtnGasealflllralldpgdevlvpsPtYpgylaaar
00456391   1/1  gltlgYlpiaGlpelreaiaelllrrygldldpdrivlvqtlsttGatealalllrallnpgdevlipdp
00450681   1/1  lrYppiaGlpelreaiaelllgeygvgldpervaivvtnGatealllaarflallnpgdevlvpdptypn
00452311   1/1  d.gelllgYppiaGlpelreaiaellfgryglgldpdriatvvtnGatealslalralkrflkgklnpgd
00428061   1/1  gllhgYpppaGlpelreaiaelllrrygvgldpervaivvtnGgtealalalrllallnpgdevlvpdpt
00350731   1/1  egllgYlpiaGlpelreaiakllfgryglaldperiatvvtnGgtealslaaeflkrflrallnpgdevl
00445231   1/1  ypdpglpelreaiaellgrryvdpeeilvtnGatealalllral...gdevlvp.PtYplyaaaarlaga
00448071   1/1  gategleelrealaellgadpayevvftsggtealeaallallkpgdevlvsapghpsvllaeaaerlGa
00501571   1/1  ryldlssglpvnplGhsppevlealaeal.drlgngssygptpgveelrealaellgadpaevlftnggt
00461651   1/1  gpgpgveelrealaellg..aeevlltsggtealelallallkpGdevlvpdptypsylaaarll.aevv
00489521   1/1  tgadviplgqgepdvppaveealallgagatgygysrgtgplrealeerlaellga..eevlltsggteA
00485711   1/1  lelllslllslyaplplvivraegaylydvdGnrylDflagigvvnlGhnhpevveaiadeeqldkllhv
00417041   1/1  gtgpgveeleealaellg..aeeavftssgteAlnlallalglgpgdevivpspthvatlaailllGakp
00405261   1/1  sagep..dfgppdeiteaaaealdqgstfleesleeaaelfallvsgwlrlsyiygyypnpglpeLreai
00511951   1/1  alaealaggrygyggnpgveeleealaellg..aeealvtsggtaaillallallkpGDevlvpapaygs
00474411   1/1  eftagleelrealaellgadpdvvlltgggtealeaallallgpgdkvlvpapgyfsvrlaelaerlgae
00380341   1/1  alagggtgydysrgpnptvealeealaellg..aeaalvtssgtaAillallallgpGDevlvpdplygs
00467471   1/1  ldvdgreyidl.asnnylglghhpavleaaiealdkygvgspgsrllygttplhdeleerlaellga..e
00507541   1/1  knlgvdplfyldgaattpvppavlealaealt.ag...npysphelsqgaleleeelaerlaellga.da
00440831   1/1  ieliageeyldalvgaglinlghghpdvvidLlsdtltgpvltaqlaellpgdryyggnpgvdeLeerla
00453921   1/1  lplvivraegaylydvdgnrylDflsgigvlnlGhnhpevvealkeqleklgytssgg.ttelaealael
00364061   1/1  pgsrlyqgtlsvdpleeeleerlaelfgae.aailltnsGtaAnlaallallkpgdevlvddlahgstla
00520701   1/1  eavlealekygvgsggsrlsygttelleeleealaellga..eevlltssGteAneaallalralgpgde
00358461   1/1  aalggldllygpsggileleealaelfg.addaifvtnGtseanlavilallgpGDevlvdrpsHksiln
00465471   1/1  .helgygatelleelrealaellgadpdeiiftsggtealnlallalrrallkpgdeilvsspehpsvlk
00367801   1/1  srggnplrealeeklaeleg..aeealvtssgtaAieaallallkpGdevlvpeplygstlellralakl
00487471   1/1  --------deleealaellga..eealvtssgteAlelallallkpGDevivpsptygatleairll.ak
00460071   1/1  greyldlssn.dylgghthpevveaaaealdklglgsggsrllygtnplheeleealaellga..eaall
00421441   1/1  slghelsrgatplleelrellaellgadpaeivftsggtealelallalrayglkpgdevlvsslehgsv
00494861   1/1  gsdpgleelrealaellgaeaaeivftsgGteAnllallalldpgdevlvsepahpsvleagaaellGak
00517571   1/1  ggdplreeleellaelfga..eaalvtssgtaAillallallkpgdeilvsrglyhgslihglklsgakv
00412601   1/1  ..ggrygrgpnpgleeleealaellg..aeevlltsggtaaif.allallgpGdevlvpaplygsylala
00480741   1/1  ...hrsgygytelleelrellaellgadedaeevlltsggtealeaallallkpgdevlvsdpahgstly
00408971   1/1  trgpgvaeleealaellg..aehavatnsgtaAlllallalglgpGDeVivpaltfvstanavllaGakp
00401341   1/1  iyllyasetpvppevlealleallnkygegnpgsryyggtlyvdplveeleerlaelfgae.aalvftns
00428091   1/1  vrlplvieraegaylydvdgnrylDflsgigvlnlGhnhpevvealaeqldrllhgsflggltelavela
00462061   1/1  gfagyrggygysrlrnptaealeralaaleg..aeevvltssgtaAialallallkpGDevlvsdplygg
00521641   1/1  eftelveearellaellgadpyeeivftgggtealeaallnllkpgdkvlvssnghfsvlaaeaaerlGa
00473401   1/1  eysrganptleeleealaellg..aeealltsggtaailaal.allkpGdevivsdpaygstlallrlll
00470951   1/1  eftelveearellaellgadpgeevvftgggtealeaallgllkpgdkvlvssnghfsvllaeiaerlGa
00357001   1/1  eishrskef..teileearellaellgapddyevvlltgggtaaleaallnllgpgdkvlvlvtghfgnr
00507531   1/1  pelsqgalelleelqerlaellgadaanvvltdggtaaleaallalrltpgdevlvpdgahpsnlaalqt
00465841   1/1  srgatelveelreklaellgadpeeviftssgtealnlalkalrlgpgdeilvsalehpsvleaarllae
00352461   1/1  kfiaeplriksaegvyltdvdgreyldalsgynvlllghgdpeiDlltDsgtsaasdaqlaallvgdday
00523021   1/1  iylsstpvfdtpeeiaaafealesg..yiysriggptveeleealaellga..eealltssgtaAlllal
00460871   1/1  klllepfrikvvepidptiaeeiekelkraggnlfllasenvyidlvsdaltgsplpamyaalevgddyy
00460561   1/1  gghelgrgalelleelrerlaellgadspdevvftsggtealnlallalaaahlkpgdevlvsalehpsn
00459731   1/1  kelkrgkdlinliasnnylppavleallealtnkygegypgsrlylgteavgplveeleerlaelfgaea
00435831   1/1  lplvivraeGaylydvdGnrylDflsgigvlnlGhnhpevveavaeqldkllhvsflglttepavelael
00500761   1/1  gadplveeleeklaellga.eaavlftsgGteAnllallaarepgdevivsataHisvleagailglgga
00529431   1/1  gttepavelaelLaellp.glekvfftnsGseAneaalklaraytgrdkiisfeggYHGrtlgalsltgs
00521571   1/1  gttelavelaekLaellp.glekvfftnsGseAneaalklaraytgrdkiisfeggYhGrtlgalsltgs
00490701   1/1  yLdnasttpvppavleamlealeelyangpsghelgrgalelveelrerlaellgadpaeivftssgtaa
00495241   1/1  aattplppevleamleallellgnphssgyslsrganplveelrerlakllgaddpeeivftsggtealn
00516011   1/1  ldplvivraegaylydvdGneylDflsglgvlnlGhshpevveaikeqldklghvsfgf.ttepavelae
00476701   1/1  --------vadwlaellglpvaflllgadpaggvftsGgteAnllallaardralprrkaeglaalgleg
00355861   1/1  eishrskeftaileearallrellgapedyevlflsGggtaafeaallnllgpgdkvlvlvtghfsvraa
00461541   1/1  kelkrqgevllliasenylspavlealgsaltn..kyaegypgsryyggteyvdpleeeleerlaelfga
00423831   1/1  llprflgavtsmpaeaaelltealnknlldpdvspgtaeleeevvsmlarllgapadnleealGaftsGg
00459091   1/1  ld...sgilsytlgpgvkelEeaiaellgakya..lavssGtaAlllallalglgpgdeVivpsptfvat
00475811   1/1  gedptvneleerlaellg.keaavfvpsGt.manllalaallqpgdevlcdelaHilldeagaleflsga
00503401   1/1  lelshrskefteileearellrellnapddyevlflsGggtgafeaallnllgpgdkvlvlvtghfsn.r
00527311   1/1  tlgptvdelEealaallga..kyavavssGtaAlllallallglgp.dgkeVivpsltfvatanaillag
00519931   1/1  --telleearellaellgakndlkyteiiftgsgtealeaalanlllllkpgdkvlvsanghfsvr.wae


                         +         -         -         -         -         *         -:210
query           TVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYF
00389521   1/1  ptYpgylaaarlatgaevvpvpldeeggflldlealeealtealkegpktkalll.pnpnNPtGtvlsle
00507681   1/1  gakvvpvpldgfgldlealeaalkeakeatpktkliylvpnpnNPtGavlsleeleallelarkhdllvi
00503901   1/1  laGakpvfvpldedgllplllglendflldlealeaai.tprtkaiil.pnpnNPtGavlsreelealae
00506961   1/1  agakvvpvpldefgldlealeaalteakekgpktkaiilvpnpnNPtGavlsleeleallelarkhdllv
00354011   1/1  lvpdptYpgylaaarlatgaevvpvpldeeggflldlealeaalteapegglktklvll.pnpnNPtGtv
00513231   1/1  lagakvvpvpldelltggllseggflldlealeaai.tpktkliil.nnpnNPtGtvlsreelealaela
00502611   1/1  yhgylaaarllGaevvfvpldedgldlealeaalteagadgllpktkavilepnpnnptGvvlppeelea
00460241   1/1  ptYpgylaaaelaGaevvpvpldeeggflldldaleaai.tpktklivl.pnpnNPtGtvlsreeleela
00509771   1/1  laaaelagakvvpvpldeeggflldlealeaal.tpktklvlltnP..nNPtGtvlsleeleallelark
00445951   1/1  fvpldleedgflldlealeaai.tprtkaill.vnpnNPtGavldleelealaelarehgllvieDeaya
00393411   1/1  aalrlaGaevvfvpldpdggflldpealeaai.tpktklvll.vnpnNptGtvldleelealaelarehg
00469651   1/1  rlaGakvvfvpldeeggflldlealeaai.tpktkaill.pnpnNPtGavlsleeleelaelarehgllv
00528621   1/1  lvpdptYpgylaaarlagakvvpvpldedgflldlealeaaitpktklillpnpnNPtGtvlsleeleal
00451711   1/1  ylaaarlagaevvpvpldeengfgldlealeaalaeatektklll.lnnpnNPtGavlsreeleelaela
00460891   1/1  aaarlagakvvevpldeegglflldlealeaaitepktkllll.cnpnNPtGavlsreelealaelarkh
00375691   1/1  gylaaarlagaevvpvpldedfgldlealeaal..pktklvvl.pnpnNPtGtvlsleeleelaela.kh
00416741   1/1  aaarlaGaevvfvpldedngfgldlealeaai.tpktkavil.enpnNPtGvvldleelealaelakkhg
00355891   1/1  lGaevvfvpldpdgtfgldlealeaai.tprtkaiil.enpnNPtGtvldleelealaelarehgllliv
00533351   1/1  ypgylaaarlaGakvvfvpldedgtfgidlealeaaiteapktkaiilepnpnnPtGvvlpleeleelae
00479561   1/1  gaevvpvpldndfgldldaleaaiktpktkllll.cnpnNPtGavlsreelealaelarehgillivDea
00497541   1/1  llGaevvfvpldedgflldlealeaalte.ktkavilepp.nnptGvvlpleeleelaelarehgilliv
00462551   1/1  lagakvvpvpldeengflflldlleleaaitpktkllllcnPnNPtGavlsreelealaelarkhgllvi
00456391   1/1  typnylaaaklagakvvpvpldeengfgldlealeaaleeatektklll.lnnphNPtGavlsreelkel
00450681   1/1  ylaiaklagaevvpvplddengfgldleallaalteapektklll.lnnpnNPtGtvlsreelkelaela
00452311   1/1  evlvpdptypnylaiaelagaenvvevplddendfgldldallaalekatpktklll.lnnpnNPtGtvl
00428061   1/1  ypnylaiarlaGaevvevpldeendfgldldaleaalteapektklll.lnnpnNPtGtvlsleelkala
00350731   1/1  vpdptypnylaiarlagaenvvevplddentfgldldallaalesatektklll.lnsphNPtGtvltpe
00445231   1/1  evvevpld.ngflldle....itpktklll.lnnPnNPtGtvlsreelealae....hgllvvsDeaYad
00448071   1/1  evvvvpvdedglldlealeaaleehrtklvileh.vnnptGvvlp...leeiaelarehgallivDeaqa
00501571   1/1  eAlelalkaarllgpgdevlvpepayHgstlaalrlagakvvevtfvpldpdglllpypdlealeaai.t
00461651   1/1  fvpldedggldlealeaait.pktklvvlenp.nnptGvvld...leeiaelakelghgallivDeayal
00489521   1/1  lelallallkpGdevlvpdptypstlaaarll.akvvgvpvdedggldlealeaaietpktkaviles.p
00485711   1/1  allsngaphepaeelaeklaelapegldkvfftnsgseaveaalklarqyglglggsrlvlgtlelheel
00417041   1/1  vfvdvdetgnidlealeaaieehtpktkaii..vvnptGvvad...leeiaeiakehgillieDaaqalg
00405261   1/1  aallggvyglavdpenivvtaGatealslallalldnltnlllkpgdevvvpdptYpgylrlakllgakv
00511951   1/1  ylallrlllkrfGaevvfvdld....dlealeaai.tpktklvvle.spsnptgtvld...leaiaelah
00474411   1/1  vvvvpvdpgglvdpeale....tpdtklvllth.penptGvvld...laaiaalarehgpdallvvDaaq
00380341   1/1  tielfglalrlaGaevvfvdld....dlealeaai.tprtklvvle.spsnptgtvad...leaiaelah
00467471   1/1  aalvfnsGteAnlaalrallgpgdivlvdelnHgstldglrlsgaevvfvphn....Dldaleallkelr
00507541   1/1  aivftsggteAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarllGaevvevpvdedgridle
00440831   1/1  ellg..aehavftnsGteAnllalkallkpgdevivpdlayggtteagllagakpvfvdvdedgnldlea
00453921   1/1  laellp..ldrvfftnsGseAnelalklarayylakgrlgtggdkilvfeggYHGrtlgalsltgspsyl
00364061   1/1  garlanasglGaevvfvpvdedglidledleaal.kektklivles..snptGvvad...lkeiaelahe
00520701   1/1  vlvdelahhsildgarllgaevvvvphn....dldaleaalteagpprtklvvles.vnnptGtiap...
00358461   1/1  ggarlaGakpvylptdrngfggiggirfkhldpealeealtelkpeglrplpktkavvltnp..nptGtv
00465471   1/1  aaellerlgaevvevpvdedgrldlealeaal.dedtklvvlt.hpnnptGvilp...leeiaelakehg
00367801   1/1  lGaevvfvdld....dledleaai.tpktklvlle.spsnptgtvld...leeiaelahenhgalvivDe
00487471   1/1  pvfvdvdedggndlealeaai.tpktkaiile.hpsnptGtvld...leeaiaelakkhgillivDeaya
00460071   1/1  fnsGteAnlaalkallgpgdivivdeltHgstldglrlsgakvvfvphn....dlealeaalaeatprtk
00421441   1/1  lraaellerlGaevvlvpvdpdgrldlealeaai.dpntklvvlehp.nnptGvvlp...leeiaelahe
00494861   1/1  vvpvp.dedgkldledleaaitedtahgllpklvvltnp.nnptGtvyslepleeiaalakehglllhvD
00517571   1/1  vfvd......dledlekaike.ktklvvl...psnptgrilsledlkeiaeiakeygallivDeahgagl
00412601   1/1  rlalkrlGaevvfvd.....ldledleaai.tektklvfle.spnNptgtvld...leeiaelakkhlln
00480741   1/1  akaakllGaevvfvpldedglidlealeaaitegpktklvvlehpsnptGvvld...leeiaelakehga
00408971   1/1  vfvdvdpdtfnidpealeaai.tprtkaiv....pvnptGavad...leaiaelarehgllvivDaahal
00401341   1/1  GtaAnlaallallkpgdevlvpslahgstlaaarlagakrlgievvfvdvdpetglidlddleaai.rpr
00428091   1/1  erlaellplgldrvfftnsGseAneaalklarayalakgtprdkilvfegaYHGrtlgalsltgsklyha
00462061   1/1  tltllrllgarggivvtfvdgldlealeaai.tektklifl.espsNptgtvld...laaiaelAhevga
00521641   1/1  evvvvpvdpgglvdlealeaaleepdtklvalthv.etstGvllplee...iaelahehgallvvDavqs
00473401   1/1  eraGaevvfvdld....dlealeaai.tprtklvlle.spsnptGtvld...leeiaelahehgalvivD
00470951   1/1  evvvvpvdegglvdlealeealkepktklvalthv.enstGvinp...leeiaelahehgallivDavqs
00357001   1/1  aadlakrlgaevvvvpvdegglldleeleaalidpdtklvalth.netstGvlnpl........lakkhg
00507531   1/1  laallGaevvvvpld....dlealeaald.edtaavllehp..nptGvvld...laalaelahaaGalli
00465841   1/1  rlgaevvfvpldeevdglldlealeaal.tpktklv.vlehvsnetGvilp...lkeiaelakehnGdls
00352461   1/1  ggdplafeleealaelfg..ldavlftnsGteAnelalkallayhrakgepgdtviisngyhgttlehvs
00523021   1/1  lallkpGDevivpaptygstaeairlllkrlGakpvfvdlde...dlealeaai.tpktkaiile.hpsn
00460871   1/1  gggptvdeleervaelfga..ehavfthsGtaAnllallallkpGdevivpdhflahggfletggaalls
00460561   1/1  laalrllaerlGaevvvvpvdpdglldlealeaal.dprtklva.lthvsnvtGvilplae...iaalah
00459731   1/1  delgvavftssGtaAlllallallkpgdevlvpslahggstlaaarllGagvnfsgllfkvvfvdvddet
00435831   1/1  laellpgglldkvfftnsGseAveaalklaraytgrtkiisfegayhGrtlgalsltgsgllrapfgpll
00500761   1/1  kvvlvpvdedgkldleaLeaairedtahvhgtrpvlveitgntetGtvysldeleeiaelcrehglllhv
00529431   1/1  gayrlgfaplpgvprlpapdtyrvpyndlealeallaehgdeiaavivep.vqgegGvivpppgflealr
00521571   1/1  padrlgfapllggvrlpapdtyrvpyn....dlealealleelgddiaavivep.vqgegGvippppgyl
00490701   1/1  lnaallalgaallsplkpgdevlvsalehgsvlaalallaerlGaevvfvdv....idlealeaal.tpd
00495241   1/1  lallalalaglkpGdevivsapehpstlaawrllaerlGaevvfvdvdedglidlealeaai.tpkTklv
00516011   1/1  kLaellpaglekvfftnsGseAneaalklaraytgrdkiisfeggYHGrtlgalsltgssyiegfgplla
00476701   1/1  lpglvilvsdpaHysvekaarllGlgvrlvpvdengrmdleaLeeaieedtaaglipaavvat.agttpt
00355861   1/1  elakrlglevvlvldaeagglvdleeleealidpdtk.lvalthnetstGvllpieeia.......ehga
00461541   1/1  ehallfanvqpssGtaAnlaallallkpgdevltpslehgGhlthgstfdatalalsglgaepvfydvdp
00423831   1/1  teanllallaarnralpkrkaaglgipgpeilvs.paHysvlkaarllgievrlvpvdendgrmdleale
00459091   1/1  anaillagakpvfvdvdpdtfnidpedleaai.tpktkaii....pvnptGnvad...ldaiaeiakkhg
00475811   1/1  klvplpgedgkldpedleaairdddvhfprtrlvslentqntegGtvypleeleeiaelArehglllhlD
00503401   1/1  aadeakrlgaevvvldaddgglldleeleeal.lnpdtklvavthneTstGvlnpleei........dhg
00527311   1/1  akpvfvdvdpdt..nidpedleaaitpktkaii..pvnllGqvad...ldeiaeiakkhglllie-----
00519931   1/1  iaerlgaevtvllpvdwggpvdleeieealde.pdtklvalvhvetstGvlnd...ikeiaelakelshg


                         -         -         -         +         -         -         -:280
query           GEARLPSLFELAREAGYPGVIYLGSFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHE
00389521   1/1  elealaelarkhgillivDeayaelvfdgppfpslasldgallllpldlgrvivlgSfSKtlglpGlRlG
00507681   1/1  eDeayaelvydgapfpslasl...dapdrvivlgsfSKtllpGlRlGylvappeliealrklrslltlgv
00503901   1/1  larkhglllieDeayaelvydgkpfpslasldge..ygrvivlgSfsKtlglpGlRlGyvvappelieal
00506961   1/1  ieDeayaelvydgkpfpslaslde...pdrvivlgSfsKtllpGlRlGylvappeliealrklrsgltlg
00354011   1/1  lsreeleellelarehglllivDeayaelvfdgapfpslaslllelglrllpdaygrvivlgsfsKtlgl
00513231   1/1  kkhglllisDeayaelvydgapftsllsl..pdaldrvivlrSfSKtfglpGlRvGylvappeliealrk
00502611   1/1  laelarehgallivDeayagfvytgkpagslaalde...lgvdivlgslsKtlggglrlGalvgdeelie
00460241   1/1  elarehgillivDeayaelvydgepkdalppslasldgl...grvivlgsfSKtfglpGlRlGylvapee
00509771   1/1  hgllvisDeayaelvydg.pfpslasldg...ydrvivlgsfSKtfglpGlRlGylvavgppelieallk
00445951   1/1  elvydg.pfpsladlda....grvivlfSfsKtlglpGlrvGylvappeliealrklrslgglgvstlaq
00393411   1/1  llvivDeayaelaydgrpapsllsldpdalgr..divvfSfsKtlglpglrvGylvadpeliealrklrs
00469651   1/1  ieDeayaelvydgkpapslasldgl..ldrvivlgSfsKtfglpGlRlGylvappeliealrklrspgns
00528621   1/1  aelarkhglllivDeayaelvfdgepppsl.....ldalgrvivlgsfSKtlglpGlRlGylvappelie
00451711   1/1  kehglllivDeayaglvygg.eedapsllaladalpr..vivlgSfsKtfglpGlRvGylvappelieal
00460891   1/1  dllvisDeaYadlvfdgapfpslasllpdl.ydrvivlrslSKtfglpGlRlGylvapnpelieallklk
00375691   1/1  galvivDeayaelvygg.pllslldllg.....rvivlgslsKtlglaGlRvGylvappeliealrklrs
00416741   1/1  lllivDeayaglvydg.kplsalallda..lgrvivlgSfsKalglpGlrlGylvadpeliealrklrsg
00355891   1/1  Deayaglvydgklpgslaeld.....gvdivlgsfsKalglpGlrlGylvadpeliealrklrsggtlgp
00533351   1/1  lakkhgillivDeayagfaydlggkgpsllelldl..gpdvivlgSfsKalglpGlrvGalvgpdeelll
00479561   1/1  yadlvydgasfvslasll.....dnvivlrSlsKafglaGlRlGylvappeelieallklrs..plgvst
00497541   1/1  Deayagfvytgklpvslaellgvag..adivvgSfsKalglpGlrlGalvgdeelidalrklrrggtftl
00462551   1/1  sDEiYadlvfdgepppsl....lldaydrvivlrslSKtfglaGlRlGylvapnelirallklrspltlg
00456391   1/1  aelakehdlllisDeaYqgfvydgleedavsiaslaelg..drvivlnsfSKtfglpGlRvGylvapnkd
00450681   1/1  kehglllivDeaYqgfaydgldedalavrsflel..ldagdnvivlrSfSKtfglaGlRvGylvappevv
00452311   1/1  tpeelkelaelakehgllvivDeaYqgfayggldedapsllal..leagenvivlrSfSKafglaGlRvG
00428061   1/1  elakehgillvvDeaYagfafggeedapsilelaga..gpnvivlgSfsKtfglaGlRvGylvapaelie
00350731   1/1  elkelaelakehgllvivDeaYqgfayggleedatsirslvelg..envivlnSfSKnfglaGlRvGylv
00445231   1/1  lvyd.......salllleaydnlivlrsfSKafglaGlRlGylianpeliealrklrsp..lnvstlaqa
00448071   1/1  lgalpgd....ldal......gvdivvfslhKalggglglGallvseellerlrpllsggtslyldllll
00501571   1/1  pktaavilep.pqnptGvvlpspeyleelaelarehgallivDeayagfgrtglpfap.....ealgv..
00461651   1/1  gvlgdplel...........gadivvgslsKtlngpgGlrgGalvgndeliealrkvrrglggtlsplaa
00489521   1/1  nnptGvvld...leeiaelakehgallivDeayaggal..gdplel.........gadivvgslsKalgg
00485711   1/1  eelladtgrekilvfsggyhgntlallaltgpgdevlvpdplypgylhaallagarvvfvpldvdedghl
00417041   1/1  alygglkaggfgga.......difsfslsKtlggg.ggGalltndeelaerlrplrlggisidlkylvqe
00405261   1/1  vfvdl.....dlealekai.tpktklvf.lesPnNPtgtvld..........akehgilvivDeaYaepv
00511951   1/1  ehgallivDeayaagvlgd...........plelgadivvgslsKalggpgdlrgGylvgseeliealrk
00474411   1/1  slgalp..........ldldelgvdvvvgslqKalggppglGflavspellerleplsgylglallldlq
00380341   1/1  khgalvivDeayatgvlgd.........plalg..adivvgslsKalggpgdrlgGyvvgsdeliealrk
00467471   1/1  eegpkpkliiveg.vfsmtGdiap...lkelreladkygallivDeahaggvlgatGrgl.lehlgvlp.
00507541   1/1  aleaai.dertaavvltn.pnnptGviep...leeiaelahehgallivDeayagglglgvdpgdl....
00440831   1/1  lekaitevgaektkaiilep.panptGvlplspadlkaireiadkhgillivDeahaaglaytgklfgse
00453921   1/1  ggfgplgagvvvvpyp....dlealeaaiepdtvaavivep.vqgegGvivpppeflkalrelcrkhgil
00364061   1/1  ygallivDeahaagllgldgrppgel.......gaDivtgslhKtl.gGprgGyiagkdelqelieklrr
00520701   1/1  lkeiaeladeygallivDeahaggvlgrtgrgla.ehlgvep.dadivvgtlhKal..GprgGalagsee
00358461   1/1  yp...leeiaelakkhglyllvDeAhgagayggpgrglaehlglpplalea..gadivvgslhKtlgalt
00465471   1/1  pdallivDaaqaagvlpld..........ldelgvDfvvfsghKal.gppgiGalyvrkell..lrpllv
00367801   1/1  ayaagvlld...........plelgadivvgslsKylggpgdlrgGyvagseeliealrklrpggglg.g
00487471   1/1  lgvlgdp.........lelga..divvfSfsKalgGptGlrgGalvgndelieallkllrggg.gggtls
00460071   1/1  avvves.vfsptGdiap...laeiaelarkhgallivDeahaggvlgrtgrgl.lellgl...gadivvg
00421441   1/1  hgallivDaaqaagal....pldlgel......gaDivvfsahKyl.ggpglGallvrdellerlrpllh
00494861   1/1  gayaggalpg.lgvsvael...dgaegadvvsfslhKtlggpg.gGallvrdelaealpllrggggetgr
00517571   1/1  vggpllpsplel......gaDivvgSlhKtl.gGprgGyiagkkelieklrkvfpglggspsplvaaall
00412601   1/1  pgalvvvDeayatpvlgd...........plelgadivvhSlsKalggagdlriGyvvgndelidalrkl
00480741   1/1  llivDaayaagalpl.dplel..........gaDivvfslhKalggppgvGallvrkelieklrpllpgg
00408971   1/1  galyggrhpgsl......ga..divsfsasKtl.tggggGavvtndeelaerlrklrnhglsrgllllvl
00401341   1/1  tklivleh..snptGrvad...leeiaelaheygallivDeAhaagllalglhglple.......gadiv
00428091   1/1  slfgpllpgvvgvpapylyrteelgyndldaleallaehgekiaavivepvvqgegGvivpppeflkalr
00462061   1/1  llvvDntyaapll..........ldpldlgadvvvhsttKklgghggvrgGylvgnpellaallkvlprl
00521641   1/1  lgal..........pidvdelgvDllvasahKglggppGlGflyvsedllerleplllgggslyldlkll
00473401   1/1  eayaagllgd...........plelgadivvgslsKylgghgdlraGylagreelidklrgllvglgggt
00470951   1/1  ..........lgalpidvdelgvDflvssshKglggppGlGflyvsekalerlknrklpplsgggdllll
00357001   1/1  allivDavssilarp...........idvdklgvdy.asaqKnlGpp.Glgvvivsedllerlepilpgy
00507531   1/1  vDaaqaal....gllvdpgal......gadivvgslhKllgPhglggpgaGalavreellralpgrlvgv
00465841   1/1  allivDaaqavgalg....ldlagl......gvDivvfslhKalggpggiGalyvrkelldrlrpllhgg
00352461   1/1  lagakvvrvpfdpaldealllpedgnldledLeklikehgadniaavilept.qnptGgqvpsleylkel
00523021   1/1  ptGtvad...leaiaelakkhgilvivDeaqatg.......gllydg.lelg..adivvfSfsKylggtG
00460871   1/1  gatpvfvdydlvdpdtgnidlekleaaikevgapktkliilenp.vnpaGgsvysladlkaireiAdkyg
00460561   1/1  ehgalvlvDaaqaagalpl.dlgel.........gaDfvvfsghKllG.ppGvGflyvrkellerlppll
00459731   1/1  gnidledleaaitepktkaiiv..vasnp.Gviad...leeiaeiakkhgallivDaAhalgavgldvlp
00435831   1/1  pgvvhvpapllyrlllleyn....dlealealieellgpdtiaavivePvqgnggvivpppgflkalrel
00500761   1/1  DgArlgnalgalgvdlaeldgaegaD....svsfslhKglgapg.ggallgrdeliekarllrkrlggll
00529431   1/1  elcdehgallivDEvqtGfgrtglfafehfgv........tpdivtlgKalggGlplgavlgsaeimdal
00521571   1/1  kalrelcdkygallivDEvqtgfrtgklfafehfgv........vpdivtlgKalggGlplgavlgseei
00490701   1/1  tklvllthv.snptGvlld...ieaiaalahehGallivDaaq...........aagllpldvgelgaDf
00495241   1/1  alv.hpsnptGvvlp...leeiaelahehgalvivDaaqaagalpid..........ldelgaDfvvfsa
00516011   1/1  gvvhvphpdtyrlpyndeleelgllllealeelleelgpddiaavivEp.vqgegGvivpppgylkelre
00476701   1/1  Gaidp...leeiaeicrehgiwlhvDaAygggalpfpeyrllldgiegaD....sitfslhKwlgvplgc
00355861   1/1  llvvDaassigs...........rpidvsgvdvvva.saqKnlg.ppGlgvlivsedllerlepi.....
00461541   1/1  etglidpdaleealr.ertpaiivag..vsaygrlad...lkelreiadevgallivDaAhaaGlvaagv
00423831   1/1  aai.dentalvvatag.ttptGaiddie...eiaelaeeygletglgiwlhvDaAyggfllpfleklrpl
00459091   1/1  llvieDaayalgalykgkkvgsf..........gdivvfSfsktKnltg.gegGaivtndkelaeklrll
00475811   1/1  GA....Rlanalvalgvslaelaglvdsvsv.glsKgl..gapvGavlvgdkdlie..karrlrkrlggg
00503401   1/1  allvvDav...........sslgslpidvdklgvdf.fsaqKnlGppG.lgvlivskdllerleplgpsy
00527311   1/1  ----------------------------------------------------------------------
00519931   1/1  allvvDavq...........slgalpidvdelgvDflvassqKgllgppGlgflyvseralerleplllg


                         -         *         -         -         -         -         +:350
query           LLKEGFSERLERVRRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVA
00389521   1/1  ylvakppeliealrklrsp..lsvsslaqaaaaaaledggfleehleelrerlrerrdllleaLee...p
00507681   1/1  sslaqaaaaaaledglydehleelrallrerrdllleaLeellppglkvlppeggfflwldlpdgldaee
00503901   1/1  rklrsaltlgvsplaqaaaaaaledgelrlerleehleelrarlrerrdllaealeel.g..lkvvppeg
00506961   1/1  vstlaqaaaaaaledggyeehleelrarlrerrdlllealkellppglevvppeggfflwldlpegldae
00354011   1/1  pGlRlGylvappeliealrklksa.tlsvstlaqaaaaaaledgelleehleelrerlrerrdllleaLe
00513231   1/1  lksalglgvstlaqaaaaaaledgllglegdeehleelrerlrerrdllaeaLeel.g..lkvlppeggf
00502611   1/1  alrklrhggtftgnplaqaaalaaledlaleehleelrarlrerrdrlaeaLeellpdlpglevvgpggg
00460241   1/1  liealrklkgggllraltlsvstlaqaaaaaaledgleehleelrerlrerrdllaealeel..pglevv
00509771   1/1  llllkslltlgvstlaqaaaaaaledg.eehleelrarlrerrdllvealee.lp.glevlkpsggfflw
00445951   1/1  aaaaaaledglflehleelrarlrerrdllleaLael...glrvlkpeggfflwldlp...daela.rll
00393411   1/1  gggstpsplaqaalaaaledg.eehleelrerlrerrdllaeaLael..pgvevvgppggfflwvdlpgl
00469651   1/1  svstlaqaaaaaaledgeflehleelrerlrerrdllleaLael.g..levlppeggfflwvdlpelgld
00528621   1/1  alrklkspltlgvsslaqaaaaaaledg.eehleelrerlrerrdlllealkelgg..lsvvkpsggffl
00451711   1/1  akvksqllllirgltlnpptlaqaaaaaaledgalreeweeeleelrarlrerrdllvealaelplpggl
00460891   1/1  spltlglvstlaqaaaaaaledg.eeyleelrarlrerrdlllealkellp.glkvlppegafflwldlp
00375691   1/1  p..lgvstlaqaaaaaaledgllehleelrerlaerrdllleaLeel..glvsvvgpsgglflwvdlp..
00416741   1/1  gtfgpsplaqaaaaaaled....eleelrerlrerrdllaeaLeel.g..levvgpsggfflwldlp.gl
00355891   1/1  splaqaaaaaaledlelleehleelrerlrerrdrlaealael.g..levvgpggglflwvdlpdlglda
00533351   1/1  lalliealrklrrpgtgspsplaqaaaaaaledlelrghwlaeleelrerlrerrdllleaLkellpllg
00479561   1/1  laqaaaaaaledg..eyleelrarlrerrdllaealeel.g..lkvlkpsggfflwldlp..ldaeelae
00497541   1/1  splaqaaalaaledl.eehleelrerlrelrdrlaeaLeel...glevlvpggglflwvdlpdllgvdae
00462551   1/1  vsslaqaaaaaallaygggeehleelrarlrerrdlllealeellp.gllvvkpeggfflwldlpellld
00456391   1/1  aelakelisalkklkrpltsnpptlaqaaaaaalsdpelreewleeleelrerlkerrdllveaLkklpt
00450681   1/1  ladaellaalisallklkraltsnpsslaqaaaaaalsdgellaewleeleemrerlkerrdllveaLre
00452311   1/1  ylvappelieallkvlsqlklliralpsnpptlgqaaaaaalsdpelralwleeleemrerlaerrdllv
00428061   1/1  alakvlsqlklliraltsnppalaqaaaaaalsdgellelwleeleelrerlaerrdllveaLaelggpg
00350731   1/1  appelieallrvksqlkllirslysnpptlgqaaaaaaLsdpelraewleeleemrarlkerrdllveaL
00445231   1/1  aaaaals..dldyleelrerlrerrdllveaLael...glevlppeggfylfldls..ldaeelaerlle
00448071   1/1  lkyeqerrfragtpnplaaaallaalellleeglealrarlaeladylaegLeel.g..lelvgppgrrs
00501571   1/1  divigslsKalggglglGavlgsdeladalrplrrgltfggnplaaaaalaalellee...eelrerlre
00461651   1/1  aallaal.....egleerrerlrenadrlaeaLael..pgvervlypglpphggfflwvdlpegrgglvs
00489521   1/1  paGlrgGalvgndeliealrklrsggggtlsplaaaallaale.....gleerrerlrenadylaeaLae
00485711   1/1  dlealeaaleeldaggdrtaavilep.vqnptGvvlppeeylkelrelarkhgillivDeayagfgrtgk
00417041   1/1  lgfnsgtspiaaaaglaal.....egleeilerrreladylaeaLkelpglelvgppglsaphlfpvllp
00405261   1/1  ydp..........lplaydndivlrSfSKyfglaGlrlGwavvpdeelidklrklklpltigvsslaqla
00511951   1/1  lllggglg.gtlspaaaaaala..gletleerrarlrenadrlaeaLael..ggvalvgypglpshpghe
00474411   1/1  ekrfepgtppvlaiaallaalellleegle.rrarlaeladalragleal...glell.pegrsggvvsf
00380341   1/1  lrlgggfg.gtlspaaaaallrgl..etlelrrarlrenadllaeaL.aelpgvvlvlypglpshpghel
00467471   1/1  dadivtgtlsKalggg.rgGailgskelidklrslarpgifstslnplaaaaalaalell..eegeelre
00507541   1/1  ...g..aDivtlslhKtlggpkgggGprlGallvrdelaealplrlggggergfvltldreqairrglag
00440831   1/1  yagvaigelvpdlfggadivsfslsKtlggp.rgGailtndeeladklrklrfpgegfplgggyrgspia
00453921   1/1  livDEvqtgfgrtgklfafehlgvt........pdivtlsKalgggglplgavlgseeiadalgpllhgg
00364061   1/1  lkaplgfgtalspliaaaalaalelleegleelaerlvenaaylaegLkel..gfvvvvgppgghivlvd
00520701   1/1  lidalrplarggtfsgtlnplaaaaalaalellgeegleelrerlralaaylaegLael...glpvvgg.
00358461   1/1  qtGwlhvrggyiagpkelidalrfnraysllystspsyplqaallaalellageegeelrerlieladyl
00465471   1/1  gggqerrfeagtpnvlaiaalaaalellge.gleairarlleladyllegLkel..pglellgppgrrgn
00367801   1/1  tlspaaaaall.rgl.etlelrreraqenadylaelLee.lglvvlvyypglpsgafyllaklpakgrgg
00487471   1/1  plaaaalla.ale.tleerlerlrenadllaeaL.eelpgvtlvlypglpshpghelakklvpgggglls
00460071   1/1  tlsKal..GgrgGavlgseelidalrplarggtfsgslnplaaaaalaalelleeegleelrerlaelaa
00421441   1/1  ggglekrfeagtpnplaiaallaalellg.eglealraralelaeylregleel..pglelvgppgrrlg
00494861   1/1  rsgllaaaalaalg...legleelaarlreladylaegLael.g..lelvgppganivfvdlp.gvdaee
00517571   1/1  aalktlllrgfkryleealklakalaeylyeglkklpglegfkvvspgggnilsfilpvdlgdgidalel
00412601   1/1  rgp..ltgstlspaaaaaalr.g.letlelrrerlaenaallaeaLeelgpgvevvlypglppegahyla
00480741   1/1  lldlvlalkylgavlgfftgtpnilgiaalaaalellgeeggleeilerlreladylyeglkel.g..le
00408971   1/1  aalllryevlllgynyrlspiqaaallaale.....tlderlerrrenadrlaelLael..pgvelvkpp
00401341   1/1  vgslhKtl.gGprgGailvrdelaeklrsllfgggfggtlspllaaallaalellee.glkerrerlven
00428091   1/1  elcdkhgilliaDEvqtgfgrtgklfafehagvt........pdivtlsKalgggglplgavlgseeiad
00462061   1/1  lggplspfqaalllrgletlplrverhte.nalalaellaalplvakvlypglpshpghllakrqlkglg
00521641   1/1  ldyllayqergfeagTppvaliyalgaalellleegleairarhreladalregleal.glellgpdpel
00473401   1/1  lspaaaaallaale.....tlelrreralenadylaelLael..pgvylvgypglpshpghelakkvlpg
00470951   1/1  lkfmladqerrfeagTppvaliaalaaalellleeGleairarhreladalregleal.glellgpdpaa
00357001   1/1  ldyktvakngstanTpptlaiyalgaalewlleeggleaiearhaelaallyealdalglvyllvvdpel
00507531   1/1  tgdadgkralrlalqtreqhirrekgtsnictpnglaaaaalaaldllgleglearaeralalanylaaa
00465841   1/1  gslilvvrfdsltlqelglrfefgtppvaaaaalgaalelleeeglleairerlreladylregLeel..
00352461   1/1  reiakkhgillilDearlaenayfgfgrtgslfaleiag...ivpdiltladvvtfslsKgggapgGgvl
00523021   1/1  drlGglvvtndkelierlrplrsggtsisyvglvtldllprrfeagtpnvagliglgaalsplqaalllr
00460871   1/1  lllivDaAraagalyaggvtgspyafrsigeivdeifgyadivsfslsKglg.gprgGaivtndeelakk
00460561   1/1  vgggqvaavsldlalqlrllerrfeagtpniagiaallaalellgeegleairarlraladylaegLaal
00459731   1/1  ......gplggaD.ivsfslhKtl.ggppGGallvndelieklrplrvgglfdlekligrarryffsgtp
00435831   1/1  cdehgilliaDEvqtgfgrtgklfafehagvv........PDivtlaKglggGlPlgavlgsaeimdala
00500761   1/1  rqagllaaaalaalge...egleellaranalarrlaegLaal..pglelvgppetnivffrlpg....e
00529431   1/1  apggpglhggtfsgnplacaaalaalelleeedllerlaelgeylregleellakhp..lvgdvrglGlm
00521571   1/1  adalrplgpglhgstfsgnplacaaalaalelleeegllerlaelgaylregleellakhp..lvgdvrg
00490701   1/1  vvfsghKtlgggppglGflyvreellerlppllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaa
00495241   1/1  hKwlgppG.iGalyvrkelldkllpllrggggivlvslfgltaaeqerrfeagtpnvaaiaalaaalell
00516011   1/1  lcdkygillivDEvqt....GfgrtgklfafehfgvvpDiv...tlgKalggGlPlgavlgskeimdalr
00476701   1/1  gallvrdkellrralsvdadylgslddggdgvrdlrdftlegsrrfralklwaalralgreglrelierl
00355861   1/1  ..lpsyldlgtlaengstynTpptfaiyglglalkllkeegglearikrhaeladllydaleal..glvl
00461541   1/1  lpspfggad.......ivtftthKtl.rGprgGailtrdelldellrllrgfgfdlakkinsavfpglqg
00423831   1/1  dfgl.....pgvdsisvsghKyglaplgcGvvlvrdkellrealsvnadylggdlgsftlegsrpgaral
00459091   1/1  rnhgtsksyhglkyvhlllgynyrlseiqAalglaqleklderlerrrenaklyaelLkklpgvelpkpp
00475811   1/1  lrqagvlaaaalvaledllellaeaherakrlaegLsel..ggvtlvlpvetnmvfvrlpgaaidalell
00503401   1/1  ldlvtlakkgstanTppvlaiyalglalewlkeeggleaiekrhaelakllydaldalglvyllgvdpel
00527311   1/1  ----------------------------------------------------------------------
00519931   1/1  ggsisfyldlklllkymeayeqekgfeagTppvlliaalgaalellleegleairarhaelaealragle


                         -         -         -         -         *         -         -:420
query           FVPGGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLALV-----------------------
00389521   1/1  glevlppegglflwvdlpalllkldgldaeelaerlleeag-----------------------------
00507681   1/1  laealleegvlvvpgsafglgglgpgylRlsfaalseeeleea---------------------------
00503901   1/1  gfflwvdlpelllkalalllllggldaeelaealleeagvl-----------------------------
00506961   1/1  elaealleegvlvrpgsafgalglgegylRlsfaalteeelee---------------------------
00354011   1/1  e.lg..levlppegglflwvdlpelllklggldaeelaerl-----------------------------
00513231   1/1  ylwvdlpelllalkllkglggldalelaerlleeagvavrpgs---------------------------
00502611   1/1  lflwvdlpdgldaealaealleagilvrpgsaftvgglgpgylRl-------------------------
00460241   1/1  ppeggfflwvdlpelllktgldaeelaerlleeagvavrpgsafg-------------------------
00509771   1/1  ldlpelgledaeelaealleeagvlvrpgsaf..gllgpgylR---------------------------
00445951   1/1  leagvavrpgsafgveglgegylRlsfgt.deedleeale------------------------------
00393411   1/1  gldaeelaeaLleeagvavrpgsaf...g.gpgllRlsvgp-----------------------------
00469651   1/1  aeelaerlleeagvlvrpgsafg..plgpgylRlsfaa.se-----------------------------
00528621   1/1  wldlpellllggddaeflarllleagvlvrpgsafgllgspgpgy-------------------------
00451711   1/1  evvvpqggmflwldlpd....efvlrllleagvl------------------------------------
00460891   1/1  elgldseelaerlleeagvlvvpgsafgllg..egylRisfat.--------------------------
00375691   1/1  .daeelaealleegvavrpgsafgv...gpgylRlsfa..t-----------------------------
00416741   1/1  daeelaealleagvlvrpgsafg....gpgllRlslal.te-----------------------------
00355891   1/1  eelaealleagvlvrpgsaf...g.gpgylRlslgl.tee------------------------------
00533351   1/1  vsvvlpsgglflfvdlp....aealakllleagvlvr---------------------------------
00479561   1/1  rlleegvlvrpgsafgllg..egylRlslg..seeeleea------------------------------
00497541   1/1  elaealleeagvlvrpgsafglgplgpgylRlsla.lte-------------------------------
00462551   1/1  daefllrllleagvavvpgsafglg..gegylRlsfa.tpeenl--------------------------
00456391   1/1  pggldvikpqggfflfldlpd.....efverlle------------------------------------
00450681   1/1  lglpgdlsvikpqggfflwvglpe....dfvarllee---------------------------------
00452311   1/1  eaLkelggpgdldvilpqggfflfldlpd....efve---------------------------------
00428061   1/1  dldvikpqggfflfldlpd....efvarllleagvl----------------------------------
00350731   1/1  eklggpgdldvilpqggmflfvglpd....efverll---------------------------------
00445231   1/1  egvlvrpg.........pgylRislatpeendrlee----------------------------------
00448071   1/1  gllvsfdlpdgvdaeelakaLleeygiavspgsafa....s-----------------------------
00501571   1/1  ladylaegLael.glelvgpvrggglflfvelpggd.aeal-----------------------------
00461651   1/1  frlkdgidaealakaleeagifviavspgsafslilhpap------------------------------
00489521   1/1  ..lggvelvlppglpshpghylavrlprglglllsfelpgdae---------------------------
00485711   1/1  pf.....alellgvddrpdivtlshKalg.G...Gav.gseel---------------------------
00417041   1/1  lpeltelllplgglllwlfllegidreelakalleagiavr-----------------------------
00405261   1/1  alaalkdpldaylllrgesletlelrrerlrerrellaeaLee---------------------------
00511951   1/1  lakkvlpgrggfv.sfdlpgggedaeafadaLkeagiavsp-----------------------------
00474411   1/1  rlpdgidaaalakaleeagiavspgsaflag....gtlRislg---------------------------
00380341   1/1  akrqlpggggivsfelkgdgedaeafadaLkeagiavspgg-----------------------------
00467471   1/1  rlrenaeylregLeel...glpv.gpsdghivlvdlgdgllak---------------------------
00507541   1/1  tgnalaiaaaaaalrllgeeglkelaerlveladylaegLkel---------------------------
00440831   1/1  aaaallal.....elleellerrvenakylaeaLeel...g-----------------------------
00453921   1/1  tfggnplacaaalaalellee...eellerlrelgdyllegle---------------------------
00364061   1/1  lpgdgidakalakaLeeagiavrpgsfptvpegsgvtsglr-----------------------------
00520701   1/1  lgaivlvdlgdgvdakalaaallleaGilvrpgsapav.p------------------------------
00358461   1/1  rkaLkkl...gflflpsdspivpvilpegafylfakid.....---------------------------
00465471   1/1  ivsfrlp.gvdaedlakallekgiavrpgsacasgllepslvl---------------------------
00367801   1/1  llsfelkgdaeavaklldelgvavrpgslggveslvihpal-----------------------------
00487471   1/1  velkdgedaeelldalkeagiavslgsafslillpasttllalgl-------------------------
00460071   1/1  rlregLael.g..levv.pglglivpvelgdgldalalae------------------------------
00421441   1/1  givsfelp.gvdaedl..lllergiavspgsacslgllppslv---------------------------
00494861   1/1  laaalleagiavspgg........pgalRlslglatte--------------------------------
00517571   1/1  aklllelygiavspgshpgvp...dgliRlsvgslghteed-----------------------------
00412601   1/1  lrvlklpgaggivsfelkg.daealaalldelgiavrp--------------------------------
00480741   1/1  llgpdgrgrggivsfrlpdgidaaakalakalleagiavspgs---------------------------
00408971   1/1  glsshafylfailvlllglgldrdelaeaLeeagiavvpgy-----------------------------
00401341   1/1  aarlaeaLeel..gfvvvvgppdghlvsvdlpglgidaldl-----------------------------
00428091   1/1  alapgalgaflhggtfggnplacaaalaalelleeedllerla---------------------------
00462061   1/1  gllsfelkggleaakafldalklfviavslggveslilhpasttha------------------------
00521641   1/1  rspgvvsfrlpegvdaeellaallerygiaispgsaclag...---------------------------
00473401   1/1  rggfv.sfdlkggvdaealadaLeeagiavslgsafslilh-----------------------------
00470951   1/1  rspgvvsfrlpegvdaeellaallerygiavsagsaclag...---------------------------
00357001   1/1  rsgmvvsftlpdgvlakaflkllkeegiavlkGhrcv......---------------------------
00507531   1/1  Leelpgv..rvlgpggaghevsfdl...gvdaedvakall------------------------------
00465841   1/1  pglelvgppggrgpivsfelpggvdaeelakaLdeagia-------------------------------
00352461   1/1  atgdkelieklrrlrkvlgegffthgglagagplalaagla-----------------------------
00523021   1/1  gl.....etldlrlerrrenadylaegLaelpgvelvlypg-----------------------------
00460871   1/1  arklrfpgegfllgggprqhgiaaaaallala.eleeyler-----------------------------
00460561   1/1  pglellgperrggivs.frlp.gvdaedlakaldeygiavr-----------------------------
00459731   1/1  pgarlaalaaalgllglegleerlerrrelakylaegLke.lglev------------------------
00435831   1/1  pllhggtfggnplacaaalaaldvleeegllerlaalgeylrdgl-------------------------
00500761   1/1  .llerllergiavspg......sagpgvlRlvtslattee------------------------------
00529431   1/1  lglelvkdkgtnilfvllpdaelaaalaaallerGvlvrpg..---------------------------
00521571   1/1  lGlmlglelvadkgtnivfvllpdaelaaalaaallerGvlvr---------------------------
00490701   1/1  laaalellglegleaiaarhleladylaegLaalpavpg.l-----------------------------
00495241   1/1  qeegleairerhreladyllegL.kelpgvllvgppgasyrlpvtlsf----------------------
00516011   1/1  pgsflhggTfsgnplacaaalaaleileeedllerlaelgeylr--------------------------
00476701   1/1  ielarylaegL.relpgfellgepelglvvfrlkpadalnlalae-------------------------
00355861   1/1  lvvdpelrspmvvtfrlpdgvdakkflkllkeagiavlgGhrs---------------------------
00461541   1/1  gplnhviaalaaalklaqleefkeyaeqvvanaralaeaLael.g-------------------------
00423831   1/1  alwaallslgregyeelverilelarylaelLekl.ggfells---------------------------
00459091   1/1  glashsa---------------------------------------------------------------
00475811   1/1  ellleegvll........vplgpglvRlvthldvseedvdeale--------------------------
00503401   1/1  rsptvvtfnlpdgvdakdflklldeagiavlkGhrca......---------------------------
00527311   1/1  ----------------------------------------------------------------------
00519931   1/1  al.glellgpladpelrsptvtavkgpegvd...llaaldergiais-----------------------