[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80551.1


[Show Plain Result]

## Summary of Sequence Search
   1::136
   6::135  3.8e-22 34.6% 0047015 00470151 1/1   -like chaperones                        
  28::128  2.7e-20 40.6% 0043616 00436161 1/1   -like chaperones                        
  36::125  3.4e-09 32.9% 0043290 00432901 1/1   -like chaperones                        
   1::136


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLERHDRLETLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRPEDLELLEEGQ
00470151   1/1  -----lllaalllllllllllllllllllllllllsllllaalalalpavdvketddayvlkadlPGvdk
00436161   1/1  ---------------------------llslllllllppvdiletddayvllldlPgvdkedlevevedn
00432901   1/1  -----------------------------------ltprydwyqtddevvitvelpgvkkedvkveieen


                         -         -         *         -         -         -         -:140
query           RVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLEVRFRKRPATALPLKEA----
00470151   1/1  edikvevedgvltisgerkseeeeeegvkylrrersygsfsRsfrLPenvdvdkvkAslenGvLt-----
00436161   1/1  vLtisgerkaeleeeeglkylrsersygsfsrsfrLpenvdvdkikAslknGvLtvtl------------
00432901   1/1  sltvsaklkdgke...........ylleleLpgeidpekskaklkdgkleitLpK---------------