[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80636.1


[Show Plain Result]

## Summary of Sequence Search
   1::443
  18::215    1e-42 37.4% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
  20::222  7.4e-38 33.5% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
 216::310  1.3e-33 41.1% 0041099 00410991 1/1   sphogluconate dehydrogenase C-terminal  
 216::314  1.2e-32 40.2% 0036487 00364871 1/1   sphogluconate dehydrogenase C-terminal  
 319::430    9e-25 37.5% 0041101 00411011 1/1   lucose/GDP-mannose dehydrogenase C-term 
 317::425  3.7e-22 32.4% 0046358 00463581 1/1   lucose/GDP-mannose dehydrogenase C-term 
  22::198  4.6e-22 29.7% 0048755 00487551 1/1   )-binding Rossmann-fold domains         
  22::215  2.9e-21 26.6% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
  22::210  2.3e-20 29.1% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
  22::224  3.9e-18 28.8% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
  22::191  6.6e-17 27.3% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
  20::190  5.6e-16 22.7% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
  20::215  2.1e-15 31.4% 0052329 00523291 1/1   )-binding Rossmann-fold domains         
  22::192  4.9e-15 23.2% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
  20::164    2e-14 28.8% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
  22::190  4.1e-14 24.4% 0045718 00457181 1/1   )-binding Rossmann-fold domains         
  20::151  1.8e-12 27.2% 0037437 00374371 1/2   )-binding Rossmann-fold domains         
  20::191  1.8e-12 26.4% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
  14::188  4.4e-12 23.3% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
  13::191  1.6e-11 23.7% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
  20::158  3.7e-10 22.9% 0047510 00475101 1/1   )-binding Rossmann-fold domains         
  22::145    5e-10 25.5% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
  20::177  1.6e-09 24.8% 0048808 00488081 1/1   )-binding Rossmann-fold domains         
  20::189  1.3e-08 25.0% 0053172 00531721 1/1   )-binding Rossmann-fold domains         
  22::190  1.3e-08 20.8% 0047278 00472781 1/1   )-binding Rossmann-fold domains         
  20::171  5.2e-08 28.1% 0042340 00423401 1/2   )-binding Rossmann-fold domains         
  20::148  1.3e-07 26.7% 0051305 00513051 1/1   )-binding Rossmann-fold domains         
   1::190  2.5e-07 21.9% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
  17::113  4.6e-07 23.8% 0050914 00509141 1/1   )-binding Rossmann-fold domains         
  20::155  5.7e-07 21.1% 0051873 00518731 1/1   )-binding Rossmann-fold domains         
  21::148  7.5e-07 22.5% 0046529 00465291 1/1   )-binding Rossmann-fold domains         
  20::148  3.5e-06 29.1% 0048757 00487571 1/1   )-binding Rossmann-fold domains         
  22::226  4.3e-06 22.1% 0042866 00428661 1/1   )-binding Rossmann-fold domains         
  22::150  6.3e-06 24.3% 0047550 00475501 1/1   )-binding Rossmann-fold domains         
  20::119  7.5e-06 20.4% 0048585 00485851 1/1   )-binding Rossmann-fold domains         
  15::125  9.1e-06 21.5% 0045481 00454811 1/1    N-terminal domain                      
  15::119  1.4e-05 25.3% 0046123 00461231 1/1   )-binding Rossmann-fold domains         
   1::135  1.6e-05 24.3% 0036746 00367461 1/1   )-binding Rossmann-fold domains         
  18::110  3.5e-05 25.6% 0050212 00502121 1/1   )-binding Rossmann-fold domains         
  21::135  5.6e-05 25.5% 0038379 00383791 1/1   )-binding Rossmann-fold domains         
  22::125  9.1e-05 23.8% 0048687 00486871 1/1    N-terminal domain                      
  20::114  0.00012 26.7% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
  21::158  0.00013 27.6% 0043276 00432761 1/1   )-binding Rossmann-fold domains         
  18::155  0.00017 21.1% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
  21::152  0.00017 30.3% 0040551 00405511 1/1   )-binding Rossmann-fold domains         
  21::186  0.00021 24.5% 0042366 00423661 1/2   )-binding Rossmann-fold domains         
  22::101  0.00027 27.5% 0036654 00366541 1/2   AD(P)-binding domain                    
  22::100  0.00028 30.4% 0036889 00368891 1/1   AD(P)-binding domain                    
  20::162  0.00029 21.6% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
  20::102   0.0003 39.3% 0036664 00366641 1/1   )-binding Rossmann-fold domains         
  16::110  0.00038 29.3% 0051213 00512131 1/1   )-binding Rossmann-fold domains         
  20::104  0.00062 22.9% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
  22::405  0.00068 31.5% 0048045 00480451 1/1   AD(P)-binding domain                    
  19::106  0.00086 31.1% 0044526 00445261 1/1   )-binding Rossmann-fold domains         
  22::190  0.00086 21.3% 0038057 00380571 1/1   )-binding Rossmann-fold domains         
  22::405  0.00091 30.4% 0048009 00480091 1/1   AD(P)-binding domain                    
  22::101   0.0077 26.6% 0048365 00483651 1/2   AD(P)-binding domain                    
 154::404     0.26 26.0% 0048365 00483652 2/2   AD(P)-binding domain                    
 304::339      3.3 42.9% 0042366 00423662 2/2   )-binding Rossmann-fold domains         
 303::426       16 25.7% 0037437 00374372 2/2   )-binding Rossmann-fold domains         
 330::404       16 28.4% 0036654 00366542 2/2   AD(P)-binding domain                    
 303::338       21 27.8% 0042340 00423402 2/2   )-binding Rossmann-fold domains         
   1::443


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTASETHLQALKEKITNRTAIVGVVGLGYVGLPFAVEKAKVGFRVIGVEQNPRRAELVNRGESYIADVPT
00482271   1/1  -----------------mk..iaviGaGyvGlplAallaeaGheVvgvDideekvealndgilpilepgl
00463571   1/1  -------------------mKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpilelgl
00410991   1/1  ----------------------------------------------------------------------
00364871   1/1  ----------------------------------------------------------------------
00411011   1/1  ----------------------------------------------------------------------
00463581   1/1  ----------------------------------------------------------------------
00487551   1/1  ---------------------mmkigviGlGlmGlplalnlakagheVvvydrnpekvealkelgapile
00481021   1/1  ---------------------lllmlkmmkiaviGaGavGtalAallaengheVtlwdrneekvellnek
00355351   1/1  ---------------------GkkvaviGlGsmGlalAallaaaGheVlvwdrdpekveelaelgapvak
00528371   1/1  ---------------------mkkvgiiGlGlmGlslalalaraGfadeVvgydrnpeklekalelgat.
00445591   1/1  ---------------------pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekleglaadlldil
00472761   1/1  -------------------ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlv
00523291   1/1  -------------------kkvgviGlGlmGlalalnlak.gfevvvydrtpekaealae..........
00479921   1/1  ---------------------pkkvaviGaGavGlalAlalaraGaageVvlvdrdeerlealaa...dl
00502691   1/1  -------------------kkvgiiGlGlmGlalarnlaaaGyeVvvydrspeklealaa..........
00457181   1/1  ---------------------mKiaviGaGyvGlslalllalkgladevvlvDideekleglaldlsdil
00374371   1/2  -------------------agrlavleaalllervltglgalagllpgkrvlViGaGgiGleaAaalarl
00452431   1/1  -------------------tisvaelalalllalarnlpgaapllragiwrasdllglelkgktvgviGl
00466731   1/1  -------------mlkikk..vaViGaGlmGsgiAavlaaaGikVvlvDidpealekalkrilklleklv
00425341   1/1  ------------lsmvlkgkkvaviGaGliGlalalllallglgeVvlyDinpekleglaadladilell
00475101   1/1  -------------------sepiadtvlvlilnllrdllgarqrlsagllrlkpllglelkgkkvviiGa
00504431   1/1  ---------------------lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpealeraldeiak
00488081   1/1  -------------------ntesvaelvlalllalarrllealalvraglwslllllglelrgktvgiiG
00531721   1/1  -------------------rrsrlllliglegqeklkgakVaviGaGgvGlalAllLalagvagevvlvD
00472781   1/1  ---------------------ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvl
00423401   1/2  -------------------aGylavllaalllcrflgglgllltlagglagkkvlviGaGgvGlaaarll
00513051   1/1  -------------------naesvaelalalllalarnlleaaallragiwrllpllglelagktvgviG
00533831   1/1  lellgvallevlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVtlvDiddelleglalelgdiisl
00509141   1/1  ----------------nkkkrvaiiGaGriGsalaralleapgfevvgvfdvdpekvgraiegl......
00518731   1/1  -------------------mkiaviGaGnyrlyaaagitnfaraaevaeevgkpeialthstitlgaelk
00465291   1/1  --------------------PctplgvllllellgillllllmmlrlkgkvalVtGassgiGralAllLa
00487571   1/1  -------------------llmkigfiGlGvmGlnlalnllkagfevtvynrtaekaeelvaegal....
00428661   1/1  ---------------------mfltlnvrelliklkllrlggleellvlalvyydddadlellkgkkiav
00475501   1/1  ---------------------iaiiGGtGniGsalAlrLaaaGheVvvvsrspekaealaeeglnllylp
00485851   1/1  -------------------mKiaviGaGnvgsalalllalagladelvlvDideeklegvaldlsdalap
00454811   1/1  --------------tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpggl.............
00461231   1/1  --------------mkmK...vaviGaGyvGlalalllallglaelvlvDideeklegv......ald.l
00367461   1/1  lellsvalhallraglvpGktVlviGaGgiGlaaalaakalGakViatdrspekleqakelgadfvvvyk
00502121   1/1  -----------------kkmKiaviGaGsvgtalalllalnlleelsglghevvlvdideerleain...
00383791   1/1  --------------------pkdvdlrvllllpeigltalealkrallelkpgsrVlviGaGgvGsaaaq
00486871   1/1  ---------------------llllllkikkvafiGlGgmGmsalAllllkaGyeVtgsDlnd.......
00517971   1/1  -------------------mkigiiGaGnmGsalakgllkaghevvvadrspekaeelaeel........
00432761   1/1  --------------------lplelaaalglalltavlavlaagvkpgktvlvlGaGgvGlaaaqlakal
00367851   1/1  -----------------kgkkvlviGaGgiGralaraLaeaGaevtvadrslekaealaael....ggve
00405511   1/1  --------------------tvlvtGaGgvGlaaaqlaaalGarViavdrseeklelare...lgadvvi
00423661   1/2  --------------------lplelgalvltlatavralllagvlpgakVlvlGaGvvGlqaaalakalG
00366541   1/2  ---------------------vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarlga
00368891   1/1  ---------------------ppipglellltsddalellelpkdvvviGgGpaGleaAlalarlglkvt
00509101   1/1  -------------------mkigiiGaGnmGralaagLlkaGhsevtvanrtpekaealaeeg.......
00366641   1/1  -------------------ntesvaelalalllalarrlpeaaagvrtgkwlllggllgrelagktvgvi
00512131   1/1  ---------------mkk...vaiiGaGyiGlslalllaekgllgkvvlvDiseerle..........gl
00387841   1/1  -------------------kkvlvtGAsGgiGsalalllakegaevvlvdrdeekalealagelldlggg
00480451   1/1  ---------------------pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarlgakvtl
00445261   1/1  ------------------pkslpllelallltglltawlplllagllpgktvgviGlGgiGlavarlaka
00380571   1/1  ---------------------vGiiGlGriGravakrlkafgmkvivydrspa.................
00480091   1/1  ---------------------ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarlgaevt
00483651   1/2  ---------------------vvviGgGpaGleaAlalarlGakVtviergdrlggrlldeelalallel
00483652   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EVLKEVVDKGLLRAETGFDRVAEMDVIVIAVPTPLTRNLTPDLQYVERVTREIAPRLRPGQLISLESTTY
00482271   1/1  eellrdlldagrltattdlaealadadvviiavgtpldadggadlsyvlaaaralakvlkklgvgaivvi
00463571   1/1  delveell.gnltattdleealkdaDlviiavgtplkdgdgrpdldivnavaeeiakll.gpdtivvsst
00410991   1/1  ----------------------------------------------------------------------
00364871   1/1  ----------------------------------------------------------------------
00411011   1/1  ----------------------------------------------------------------------
00463581   1/1  ----------------------------------------------------------------------
00487551   1/1  ..........lknltaatsleelvellkdadvvilavptp.........savkevlegllpllkpgaivi
00481021   1/1  genpiylpglelp.....enltattdleeavkdadlviiavptd..........alrsvlrqlakllkdv
00355351   1/1  ylpglell....grlrattdleealadaDvvilavptp..........avrsvlaelapllkpgaivvdl
00528371   1/1  ..............dliaatdlaealkdaDvvilavptp..........avrevleellpllkpgailid
00445591   1/1  elllve.......rlitttdleealadaDvviiavgtprkpgmlrldlladnlgivkavaealakllkpg
00472761   1/1  Dideekleglardlldilellgv........glvvttdleealkgaDvviiatgvprkpgmlrldllkan
00523291   1/1  ........lgav.aaslaealaeadvvilavpap.........aavrevlegllpllkpgaividlstgs
00479921   1/1  edllellgvdlra.....ttdleealkdaDlviiavgvplkpglvrld..................lasn
00502691   1/1  ........lgaevaaslaealadadvvilavplp......aavkavlnglaellallkpgailidvssgl
00457181   1/1  eplle.........vlittdlyealkdadvviiavgtprkpgmsrddllvvna.................
00374371   1/2  GakVtvvdrrpellerleelgakfvlltldeelvevvlaltvdvsdeegrlkavetleellgeaDvviva
00452431   1/1  GriGlalarllaalGakVivydrspekleel...dglgvdsleellke..................aDvv
00466731   1/1  klgllsaaeallllleallgritattdladaladadlvieavp........enldlkkkvfaelekllkp
00425341   1/1  lvk.......grirattdlyealkgaDvviiavgvprkpgl.............iaellkrgdllvtnas
00475101   1/1  GnvGralakvlralGaevtvydidesrleel..dgrvvd...................sledllkdaDvv
00504431   1/1  lllklvlkgllvelllgaal.....aritgttdlealadadlVieavpe........nldvklavlaele
00488081   1/1  lGriGlalarrlaafgmkVlvydrspkaaaa......................gaaeavsleellaeaDv
00531721   1/1  idevklsnlardllhiladlgvpkvvva........nleealadaDvviiaagvprkpgmlrldlllana
00472781   1/1  vdideekleglalelidillpklvdvvvtte........lkevlkgaDvvilatgaprlpgalrldlvet
00423401   1/2  aalGakVtvldrnpekleqleelgadav...........evdvsdtadleelvaeaDvvinaagipgat.
00513051   1/1  lGriGravarrlaafGaeVivydrspeaaealelga....................tvvsleellaeaDv
00533831   1/1  lgk........alkvdtddeealldaDlvilatgaplkpgqevldlletnlkivyavgeeikkaappail
00509141   1/1  ...........pvlgvddleelleggvdvvilavPaeaaqeva---------------------------
00518731   1/1  elalgldevvlgepvfmGsgiAlvadevlaeagmkvaligisgligsslaralkkkg....kevivsnrs
00465291   1/1  reGatVvvvdrneekleelaeeieaaggkavvldvsdeedlkelv...............grlDilvnna
00487571   1/1  ......elkllgalvaeslvealekadvvilmvpag.........aavdevldgllpllkkgdiiidgst
00428661   1/1  iGyGsmGlaiAlnLrdsgldVvlydrnevglrkgssslekaeelgvill...............vltvad
00475501   1/1  gvtaa...........dlaeaaegaDvvilavppe..........avrevleelapll.egkivvdvtng
00485851   1/1  llvd.......gvivttdlyealkdadvvvitagvprkpgmsrldllvr---------------------
00454811   1/1  ..lllelgvefvlgslllellleadlvvlspgvpl...dhpllelarelgievig---------------
00461231   1/1  edllarlladvriattdlyealkdadvviiaagtprkpgmdldlplrld---------------------
00367461   1/1  dl...........sediieavaellatngggadividtagipg.............ileeavdll-----
00502121   1/1  ....ldlekylpelglplnivattdleeAlkgaDfviiav------------------------------
00383791   1/1  llaaaGvgkvilvDrdeealerarrlgpdvvvdpiedlaeallellgg........rgvDlvldc-----
00486871   1/1  ..........pallelleelgievvlghdaelladadlvvvslaipld...npel---------------
00517971   1/1  .........gvtaatsleelledaDvvilavppqlveevlkalk--------------------------
00432761   1/1  GakVvavdiseeklelakelGadfvvvykd..ed.......vaeavleltggadvvidtagipg......
00367851   1/1  avelDvtdeasldaal.....gdaDvvinaapvglhaeiveaaleagkhvvdenpla.aetralleaake
00405511   1/1  dvtd.edlveavleltg.....gvDvvvdaagvpa.............tleealrllkpggrlvlvgvag
00423661   1/2  ageVtvvDisperleqaee...lGadlvvvpse.edlaeavreltg.kqgggaDlvitaagipg......
00366541   1/2  kvtvvergdrlggtldpelskallelleklg---------------------------------------
00368891   1/1  liergdrlgglldpelaaallelleklgve----------------------------------------
00509101   1/1  ...........gvvaaslaealadadvvilavkpqaveevlaelagkgalvidiaagipieelaealpea
00366641   1/1  GlGniGlavarrlaalGakVivydrspralee--------------------------------------
00512131   1/1  aldlldallilldlkittdlkealkdadvvviaagtplke------------------------------
00387841   1/1  alvlvadvtdleav..edlvealggadvvvnnag------------------------------------
00480451   1/1  verrdrlgglld..........................................................
00445261   1/1  lGarViaydrspeklelakelgadfvvvysdedsle----------------------------------
00380571   1/1  .kaeeaaelgattvvsldellaeaDvvvlhvplt........petrglinaellallkpgailintargg
00480091   1/1  vvergdrlgglld.........................................................
00483651   1/2  leklgvelllgtevteidgdgggv.vvltdg---------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PGTTEEVMLPILEQSGLKVEEDFFLVHSPERVDPGNKRYTTRNTTKVVGGVGPRSLEAGVFFYSQTIEKV
00482271   1/1  estvpvgtteellaplledlsglvvgldfvllsnPeflreGkalgdlllpdrvviGgtdeealelavely
00463571   1/1  vpvgtteylatpll.........gidvlssPeflregaallhllnpdrvvvgslspeaaerlralyesll
00410991   1/1  ----------------------------------------------------------------------
00364871   1/1  ----------------------------------------------------------------------
00411011   1/1  ----------------------------------------------------------------------
00463581   1/1  ----------------------------------------------------------------------
00487551   1/1  dtstvspgtteelaklleekgilfvdapvsggpagaglgltilvggdeealekvkpll------------
00481021   1/1  llkkgaiivsltsgipvgtlallseiieevlg...ghpfavlsgPefarev...aeglptavtiagedee
00355351   1/1  stglvgtieallaallegvlalagldvldaplsgpeflaeggalllvanvlltpivvgggdeealelale
00528371   1/1  vssgkpittealaeal........gervigahpvsggevgapegaladlfegplviltpmagg.......
00445591   1/1  vil...............................vasnPedlligiaakll-------------------
00472761   1/1  lkivkavaealakyapdaivl.............................--------------------
00523291   1/1  pldtealaealeekgilfldapvsggepgaragp..........ltimaggdeealervrpllealg.av
00479921   1/1  nsgividvlaall.......klppdvivlvvsnPvdlmelvelilgllpskr------------------
00502691   1/1  pvdtealaaalaeggilvaglpvf----------------------------------------------
00457181   1/1  ........kivkeiaeaiaklapdaivlvvsnPvdlltgvalkdsglpdr--------------------
00374371   1/2  agippatap..-----------------------------------------------------------
00452431   1/1  ilavplt........petkglinaellallkpgailvnvarggvvdeaall-------------------
00466731   1/1  d.ailasnTsslsite..laealkrpervlglhff...nPvrlmplvE----------------------
00425341   1/1  ilvdiieala.......klapdaivlvvsnPvdimtlvalklsglpsrrvi-------------------
00475101   1/1  iiatpln........lst----------------------------------------------------
00504431   1/1  allkp-----------------------------------------------------------------
00488081   1/1  vvlhvplt........petrglinaellallkpgail---------------------------------
00531721   1/1  pivksvaeaiakyapda..ivlvvtnPvdtltyialk............---------------------
00472781   1/1  nldivllvveelvkyapevlil............................--------------------
00423401   1/2  ......apllvtrellelmkpgsvivdvaid---------------------------------------
00513051   1/1  vilavplt--------------------------------------------------------------
00533831   1/1  l...............................vvtnPvavlelivlkltg--------------------
00509141   1/1  ----------------------------------------------------------------------
00518731   1/1  aatlerleelGvkvt-------------------------------------------------------
00465291   1/1  gipllkpl--------------------------------------------------------------
00487571   1/1  sspedtrr--------------------------------------------------------------
00428661   1/1  laeavagADlvilavpdeata..........dvleeiapllkpgail.sfahGisidelala.gillpad
00475501   1/1  lpidtllllv------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00432761   1/1  .......ilreilrllkp----------------------------------------------------
00367851   1/1  agvgrivnvssaagy-------------------------------------------------------
00405511   1/1  g.llpldlarll----------------------------------------------------------
00423661   1/2  .......vlrealevmkpggvvvdvaidqg..eltlplttlvlkgv------------------------
00366541   1/2  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00509101   1/1  glvvrdmpnlgalvgagatalt------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00480451   1/1  ......................................................................
00445261   1/1  ----------------------------------------------------------------------
00380571   1/1  lvdeaallealesggiagaglDVfepeplv..dgpllglpnviltphigg--------------------
00480091   1/1  ......................................................................
00483651   1/2  ----------------------------------------------------------------------
00483652   2/2  -------------ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGa.kV
00423662   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VPVSSAKAAELVKVFENTFRAVNIALVNELAMLCDRMGLNVWEVLDAAFTKPFGIMPFYPGPGVGGHCIP
00482271   1/1  epivk-----------------------------------------------------------------
00463571   1/1  kadvpilvtdli----------------------------------------------------------
00410991   1/1  -----lrtAElvKlaenaflavkiafanelallaealgidvlevieaagldpriglgfllllPglGfGGs
00364871   1/1  -----lrtAElvKlaenaflavkiafaNelallaealgidvlevieaagldprigllfllPglGfGGscl
00411011   1/1  ----------------------------------------------------------------------
00463581   1/1  ----------------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00481021   1/1  aaell-----------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00528371   1/1  deealelvlpllea--------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00523291   1/1  vyvgd-----------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00428661   1/1  vdV.....imvaPklp------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00480451   1/1  ......................................................................
00445261   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00480091   1/1  ......................................................................
00483651   1/2  ----------------------------------------------------------------------
00483652   2/2  tvierg.......................................................drlggrlld
00423662   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IDPHYLEWKAKEYNFNTHFIALAGEINRKMPEFTVEKALRVLAEAGVPVRGAKVLVLGVAYKRDIPDYRE
00482271   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00410991   1/1  ClpkdplallalaeelgvelrlleavlevN----------------------------------------
00364871   1/1  pkdplallalae..gvelrlleavlevnelqkel------------------------------------
00411011   1/1  --------------------------------------lkllaklglslkgkkvavlGlaFKpntdDlRe
00463581   1/1  ------------------------------------lvvkllaklildlkgkkvavlGlafKentdDlRe
00487551   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00480451   1/1  ......................................................................
00445261   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00480091   1/1  ......................................................................
00483651   1/2  ----------------------------------------------------------------------
00483652   2/2  .....................................................................e
00423662   2/2  -----------------------lplelgalvltlatavralllagv.lpgakVlvlGa-----------
00374372   2/2  ----------------------agrlavleaalllervltglgalagllpgkrvlViGaGg.........
00366542   2/2  -------------------------------------------------lgakvtvverg.drlggtldp
00423402   2/2  ----------------------aGylavllaalllcrflgglgllltlagglagkkvl------------


                         -         -         -         -         *         -         -:420
query           SPAIEVIRGLRRLGAEVEYHDPHVPRFAEGGLAMESVPLSEERVREKDLVLIATDHSAFDYKAIVAQARR
00482271   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00410991   1/1  ----------------------------------------------------------------------
00364871   1/1  ----------------------------------------------------------------------
00411011   1/1  spaldiikeLlelgaevvvyDPvveeeaallllellllsellllgltlvddleealegadavvlltehde
00463581   1/1  spaldiikeLlekgaevvvydPvvdeeevfl.ellvlldleealkgadaivlltehdefkdldvvvdtrn
00487551   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00480451   1/1  ......................pelaaallelleklgvelllgtrvtaidldggg---------------
00445261   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00480091   1/1  .......................eelsllllelleklgvelllgtrvtaidvdgd---------------
00483651   1/2  ----------------------------------------------------------------------
00483652   2/2  elalallelleklgvelllgtevteidgdgggv...vvltdgetleadlvvlAt----------------
00423662   2/2  ----------------------------------------------------------------------
00374372   2/2  .iGleaAaalarlGakVtvvdrr.pellerleelgakfvlltldeelvevvlaltvdvsdeegrlkavet
00366542   2/2  elskallelleklgvevllgtevtaidvdgdgvtvtvldvvlgdgetleadlvl----------------
00423402   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VLDARGATRHLPRELTEGKVVLL-----------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00410991   1/1  ----------------------------------------------------------------------
00364871   1/1  ----------------------------------------------------------------------
00411011   1/1  fkdldlkllk------------------------------------------------------------
00463581   1/1  lldpd-----------------------------------------------------------------
00487551   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------
00457181   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00475101   1/1  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00488081   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00472781   1/1  ----------------------------------------------------------------------
00423401   1/2  ----------------------------------------------------------------------
00513051   1/1  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00509141   1/1  ----------------------------------------------------------------------
00518731   1/1  ----------------------------------------------------------------------
00465291   1/1  ----------------------------------------------------------------------
00487571   1/1  ----------------------------------------------------------------------
00428661   1/1  ----------------------------------------------------------------------
00475501   1/1  ----------------------------------------------------------------------
00485851   1/1  ----------------------------------------------------------------------
00454811   1/1  ----------------------------------------------------------------------
00461231   1/1  ----------------------------------------------------------------------
00367461   1/1  ----------------------------------------------------------------------
00502121   1/1  ----------------------------------------------------------------------
00383791   1/1  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00432761   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00405511   1/1  ----------------------------------------------------------------------
00423661   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00368891   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00512131   1/1  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00480451   1/1  ----------------------------------------------------------------------
00445261   1/1  ----------------------------------------------------------------------
00380571   1/1  ----------------------------------------------------------------------
00480091   1/1  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00423662   2/2  ----------------------------------------------------------------------
00374372   2/2  leellg----------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00423402   2/2  ----------------------------------------------------------------------