[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80650.1


[Show Plain Result]

## Summary of Sequence Search
   1::399
   1::384  4.3e-48 41.1% 0042501 00425011 1/1   eneral substrate transporter            
   1::380  8.5e-45 37.6% 0042480 00424801 1/1   eneral substrate transporter            
   1::399


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDRRLLALLSGVLLGTVSESSLAPALPVLERAFAVGPEAAQGVVSLGLLGAALAYLPLAGLAGRVGAGRL
00425011   1/1  Msdsssseeddpelprpllrrrrwrillllflgyflagldrsiigpalpll.edlglsaaqaglllsaff
00424801   1/1  MkekrrrvllllflgyflsgldfgligpllplilkdflglsaaqigllfsayllgaalgsplaGrlsDrf


                         -         -         *         -         -         -         -:140
query           FRTGLFLHALSALLLALAPSLLALYLLRLLQGVATAMVVGLVPGLAASAFPEARGYALGMVASTVAAGTL
00425011   1/1  lgyalgallaGplaDrfGrrrvlllglllfalgslllalaallgpslalllllrflqGlgagglfpaala
00424801   1/1  GrrkvlllglllfalgslllafaptystslwlllllrflqGlgagglfpaalaliaelfppeerglaley


                         +         -         -         -         -         *         -:210
query           LGPALGGLAAGWGLPYVFLLPLPAALLALLLSGNLPELPRQEGTLPGLLRAPGFLPALLATGLYFLHALG
00425011   1/1  llaewfppkergralglfgaggglGgalgpllggllleldlgWrwafliaailalllalllllllpespr
00424801   1/1  gllsaggslGallgpllggllldlgwrlvfliaailalllllllllflpesprflaakgkleeekkaslk


                         -         -         -         +         -         -         -:280
query           TTVALAFHLGKEGFSPGAIGGLLLLGPLELLFLGAWAGRRADRMGYNRVALLGAYLLVAAGLAFALLPLL
00425011   1/1  flllkglseeerkvlerrlkadaeakaasplsllellrnprflllllayfllflgfyglltflplylqev
00424801   1/1  lslkellknprllllllavfllflgfyalltylplylqslfevlglsasqaglllalfglggilgsllag


                         -         *         -         -         -         -         +:350
query           HPLWGSALALLLLGVGRALFQAANNALVLSLAPKGTEGLASGALSVARALGQALGSALAGGSLGLFYRLF
00425011   1/1  lglsasqaglllalfglggilgsllagrlsdrlpegrrrrllliglllaalgllllallp.gtslallll
00424801   1/1  rlsdrlgrrrllligllllalgllllal...apslwllllllillgfgfglafpllfallselfppelrg


                         -         -         -         -         *         -         -:420
query           PSHGLAFAATALLLTALMGLAAFLVRGREGSGEEVGHAPLDDPGGEGGA---------------------
00425011   1/1  llfllgfglggafpllfalvaelfppelrgtasg------------------------------------
00424801   1/1  talgllnllagslggalgpllagllldal.----------------------------------------