[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80689.1


[Show Plain Result]

## Summary of Sequence Search
   1::257
   3::254  2.3e-49 37.8% 0042551 00425511 1/1   /beta-Hydrolases                        
   2::254  7.3e-49 36.5% 0041081 00410811 1/1   /beta-Hydrolases                        
   2::253  9.8e-47 35.3% 0037013 00370131 1/1   /beta-Hydrolases                        
   3::254  7.6e-46 36.9% 0050112 00501121 1/1   /beta-Hydrolases                        
   2::255  1.5e-45 36.1% 0046219 00462191 1/1   /beta-Hydrolases                        
   2::257  3.3e-45 36.2% 0049094 00490941 1/1   /beta-Hydrolases                        
   3::252  1.4e-44 37.1% 0045851 00458511 1/1   /beta-Hydrolases                        
   3::253  1.9e-44 36.3% 0046573 00465731 1/1   /beta-Hydrolases                        
   3::254  2.2e-44 47.8% 0048982 00489821 1/1   /beta-Hydrolases                        
   3::256  2.4e-44 35.8% 0045984 00459841 1/1   /beta-Hydrolases                        
   2::255  2.5e-44 34.0% 0048207 00482071 1/1   /beta-Hydrolases                        
   3::253    3e-44 36.9% 0050206 00502061 1/1   /beta-Hydrolases                        
   3::254  6.5e-44 35.5% 0046077 00460771 1/1   /beta-Hydrolases                        
   3::253  8.7e-44 39.2% 0047495 00474951 1/1   /beta-Hydrolases                        
   3::254  1.1e-43 36.1% 0046004 00460041 1/1   /beta-Hydrolases                        
   3::257  1.3e-43 36.5% 0047444 00474441 1/1   /beta-Hydrolases                        
   3::254  4.2e-43 35.2% 0045736 00457361 1/1   /beta-Hydrolases                        
   9::256  4.5e-43 36.7% 0046410 00464101 1/1   /beta-Hydrolases                        
   3::254  4.6e-43 36.4% 0045742 00457421 1/1   /beta-Hydrolases                        
   3::254  5.3e-43 38.0% 0045741 00457411 1/1   /beta-Hydrolases                        
   2::254    6e-43 38.2% 0047194 00471941 1/1   /beta-Hydrolases                        
   3::255  2.2e-42 37.6% 0049631 00496311 1/1   /beta-Hydrolases                        
   3::255  4.4e-42 35.1% 0049001 00490011 1/1   /beta-Hydrolases                        
   3::256  4.8e-42 36.0% 0045886 00458861 1/1   /beta-Hydrolases                        
  11::256  4.9e-42 35.4% 0051001 00510011 1/1   /beta-Hydrolases                        
   3::255  5.1e-41 33.2% 0047200 00472001 1/1   /beta-Hydrolases                        
  13::256  3.8e-40 38.5% 0048965 00489651 1/1   /beta-Hydrolases                        
   3::258  6.5e-40 38.4% 0048075 00480751 1/1   /beta-Hydrolases                        
   3::255  3.1e-39 34.3% 0047683 00476831 1/1   /beta-Hydrolases                        
   3::255  7.1e-39 33.9% 0048460 00484601 1/1   /beta-Hydrolases                        
   3::258  3.7e-38 35.3% 0049037 00490371 1/1   /beta-Hydrolases                        
   3::258  2.1e-37 37.9% 0053045 00530451 1/1   /beta-Hydrolases                        
   3::254  5.2e-37 40.5% 0048194 00481941 1/1   /beta-Hydrolases                        
   5::254  5.6e-37 39.2% 0053348 00533481 1/1   /beta-Hydrolases                        
   3::253  5.7e-37 36.6% 0050245 00502451 1/1   /beta-Hydrolases                        
   4::255  1.2e-36 34.2% 0049087 00490871 1/1   /beta-Hydrolases                        
   3::255  2.9e-36 41.9% 0047388 00473881 1/1   /beta-Hydrolases                        
   4::254  3.8e-36 37.0% 0047940 00479401 1/1   /beta-Hydrolases                        
   2::252  1.9e-35 41.5% 0047627 00476271 1/1   /beta-Hydrolases                        
   4::255  3.6e-34 34.6% 0046221 00462211 1/1   /beta-Hydrolases                        
   8::255  1.5e-33 39.4% 0046793 00467931 1/1   /beta-Hydrolases                        
   2::252  3.1e-33 40.3% 0049887 00498871 1/1   /beta-Hydrolases                        
   6::254  3.4e-33 33.6% 0037239 00372391 1/1   /beta-Hydrolases                        
  12::257  1.4e-32 38.0% 0044560 00445601 1/1   /beta-Hydrolases                        
   8::257  1.6e-32 33.2% 0047764 00477641 1/1   /beta-Hydrolases                        
   9::259  2.4e-32 35.6% 0048633 00486331 1/1   /beta-Hydrolases                        
   3::255  2.8e-32 36.1% 0048945 00489451 1/1   /beta-Hydrolases                        
  11::253    5e-32 33.8% 0042339 00423391 1/1   /beta-Hydrolases                        
   9::254  1.2e-31 37.4% 0036443 00364431 1/1   /beta-Hydrolases                        
   9::253  1.8e-31 41.1% 0045824 00458241 1/1   /beta-Hydrolases                        
   9::253  8.9e-31 41.5% 0047600 00476001 1/1   /beta-Hydrolases                        
  13::257  2.9e-30 37.7% 0047317 00473171 1/1   /beta-Hydrolases                        
   6::253  1.4e-29 34.4% 0047879 00478791 1/1   /beta-Hydrolases                        
   3::254  1.8e-29 33.3% 0048053 00480531 1/1   /beta-Hydrolases                        
   4::254  2.1e-29 38.2% 0039526 00395261 1/1   /beta-Hydrolases                        
   9::257  2.7e-29 33.8% 0047601 00476011 1/1   /beta-Hydrolases                        
   2::254  3.2e-29 37.4% 0040046 00400461 1/1   /beta-Hydrolases                        
  13::255    9e-29 36.5% 0050226 00502261 1/1   /beta-Hydrolases                        
  10::254    1e-28 31.5% 0048003 00480031 1/1   /beta-Hydrolases                        
   2::114    1e-27 41.4% 0047034 00470341 1/1   /beta-Hydrolases                        
   9::257  1.2e-27 33.2% 0046639 00466391 1/1   /beta-Hydrolases                        
  11::259  7.4e-27 32.4% 0049383 00493831 1/1   /beta-Hydrolases                        
   2::114  2.4e-26 40.7% 0046624 00466241 1/1   /beta-Hydrolases                        
   2::114  3.7e-26 40.7% 0046012 00460121 1/1   /beta-Hydrolases                        
   9::114  2.9e-25 40.6% 0048008 00480081 1/1   /beta-Hydrolases                        
   2::114  3.7e-25 42.5% 0047220 00472201 1/1   /beta-Hydrolases                        
   5::259  6.5e-25 32.8% 0047592 00475921 1/1   /beta-Hydrolases                        
   9::256  6.7e-25 36.0% 0051883 00518831 1/1   /beta-Hydrolases                        
   3::257  4.8e-24 32.9% 0046670 00466701 1/1   /beta-Hydrolases                        
  12::226  3.1e-22 30.3% 0049128 00491281 1/1   /beta-Hydrolases                        
   9::253    5e-22 34.7% 0047003 00470031 1/1   /beta-Hydrolases                        
   9::110  1.2e-21 42.6% 0043326 00433261 1/1   /beta-Hydrolases                        
   9::253  2.5e-20 29.6% 0051009 00510091 1/1   /beta-Hydrolases                        
   9::255  4.5e-19 35.1% 0039602 00396021 1/1   /beta-Hydrolases                        
   9::254    5e-18 32.3% 0048825 00488251 1/1   /beta-Hydrolases                        
  12::257  4.6e-17 31.2% 0049591 00495911 1/1   /beta-Hydrolases                        
   9::255  5.8e-14 32.7% 0041193 00411931 1/1   /beta-Hydrolases                        
   8::129  1.1e-11 33.6% 0037021 00370211 1/1   /beta-Hydrolases                        
   9::125  1.3e-11 27.0% 0049638 00496381 1/1   /beta-Hydrolases                        
   9::255  2.6e-09 30.1% 0046388 00463881 1/1   /beta-Hydrolases                        
   7::225  2.7e-09 31.0% 0046412 00464121 1/1   /beta-Hydrolases                        
   9::125  5.9e-09 28.7% 0050010 00500101 1/1   /beta-Hydrolases                        
  37::256  1.3e-08 27.3% 0050947 00509471 1/1   /beta-Hydrolases                        
   9::125  1.5e-08 30.9% 0049637 00496371 1/1   /beta-Hydrolases                        
   7::225  1.8e-08 30.6% 0048126 00481261 1/1   /beta-Hydrolases                        
   9::226    8e-08 28.3% 0046502 00465021 1/1   /beta-Hydrolases                        
   7::162  2.9e-07 29.2% 0046729 00467291 1/1   /beta-Hydrolases                        
   9::225    3e-07 31.4% 0048675 00486751 1/1   /beta-Hydrolases                        
   9::110  6.4e-07 28.9% 0047974 00479741 1/1   /beta-Hydrolases                        
   9::226  1.3e-06 29.5% 0048935 00489351 1/1   /beta-Hydrolases                        
  36::256  4.9e-05 28.0% 0041128 00411281 1/1   /beta-Hydrolases                        
   7::225  0.00013 29.5% 0049630 00496301 1/1   /beta-Hydrolases                        
   9::125  0.00028 25.5% 0053336 00533361 1/1   /beta-Hydrolases                        
   9::108  0.00067 35.0% 0047451 00474511 1/2   /beta-Hydrolases                        
 185::257      1.1 24.7% 0047451 00474512 2/2   /beta-Hydrolases                        
   1::257


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARLRYRLEGEGPPVVLLNGIFQRLESWDPVLPHLTGFTLLRYDMRGQGESEAPEGPYPPRAHAEDLLAL
00425511   1/1  --eertvtvdgvrlayreygppdgppvlllHGlggssaswrplapalllaagyrviapDlrGhGrSdgpp
00410811   1/1  -peegrfvtvdglrlhyrevgppdgkptvvllHGgpggssgswrplipaLaegyrviapDlrGhGrSdpp
00370131   1/1  -peallnpfesryvtvdglrlhylevGdgppllllHGfpgsssswrplipaLakgyrviapDlrGhGrSd
00501121   1/1  --erfvtvdglrlhyreagpgppvvllHGlggsseswrplaeaLaerGyrviapDlrGhGrSdgppsdys
00462191   1/1  -lpllpfesrfvtvdglrlhyreaGpGppvlllHGfpgssysWrplipaLaagyrviapDlrGhGrSdkp
00490941   1/1  -vdglrlhyrewgppdgppvvllHGlggssaswrplapaLaaagyrvialDlpGhGrSdgpp.dysledl
00458511   1/1  --lrllepllvpveertvttpdGlrlhyreygppsgppvvllHGlggsseswr..apaLaaalgyrviap
00465731   1/1  --lelepllnpveertvtvgdGlrlhyreagpgppvvllHGlggsseswrplaeaLaeaGyrviapDlrG
00489821   1/1  --llllllllllllllllllvlllllllkllepllnpveertvtvdglrlhyrlygpgdgppvvllHGlg
00459841   1/1  --maalvpfeertvtvdglrlhyreygppsgppvvllHGlggsseswrplapaLaegyrviapDlrGhGr
00482071   1/1  -lallllllltlllpallpppgvpveevtvptpdGvrlhyrlylPagggklPvvvllHGgggssgsagsw
00502061   1/1  --lPeelplvpfeertvttpdGlrlhyreagdgppvvllHGlggsseswrplapaLadrGyrviapDlrG
00460771   1/1  --elpfeertvtvdglrlhyleagpgdkppvvllHGlgpGpgsseswrplapaLaegyrviapDlrGhGr
00474951   1/1  --mleertvttdglrlhyreagsgppvvllHGlggvigsseswrplaeaLaagyrviapDlrGhGlSdgp
00460041   1/1  --PpeterlvtvdglrlhyreagpgppvvllHGlggsseswrplaeaLaarGyrviapDlrGhGrSdgpp
00474441   1/1  --pveegrfvtvdglrlhyreagsgppvvllHGlggglgsseswrplapaLaegyrviapDlrGhGlSdg
00457361   1/1  --erfvtvdglrlhyreygpgdkppvvllHGlggsseswrplapaLaeaGyrviapDlrGhGrSdgppsd
00464101   1/1  --------PpgggsgppvvllHGlggsseswrplaeaLaarGyrviapDlrGhGrSdgppspdysledla
00457421   1/1  --sefvtvdglrlhyreagpgppvvllHGlggsseswrplaeaLaerGyrviapDlrGhGlSdgppsdys
00457411   1/1  --prfvtvdglrlhyreagdgppvvllHGlggsseswrplaeaLaerGyrviapDlrGhGrSdgppgdys
00471941   1/1  -efvtvdggdllllrlhyreagdgppvvllHGlggsseswrplaeaLaerGyrviapDlrGhGrSdgppg
00496311   1/1  --maldllvtvttpdGvrlayrlylPagagpkkgppvvllHGgggsseswrplaeaLaarGyrVvapDlr
00490011   1/1  --lllsllplkadlsirPfkisvpdeelddlrarleltrlpdpplvlegadwsyGvpldllkelvdywln
00458861   1/1  --lllllrywrdifdwltlepllvpfeefvtvsdglrlhyreygppdgppvvlllHGlggsseswrplae
00510011   1/1  ----------dgppvvllHGlggsseswrplapaLaerGyrviapDlrGhGrSdgppsplysledladdl
00472001   1/1  --dlellldisellkklgvpveevtvttpdGvrlhyrlylpkpppppgggpgppvlllHGlggssgswld
00489651   1/1  ------------ggaalvllHGlggsseswrplapaLaerGyrviapDlrGhGrSdgppgpdysledlad
00480751   1/1  --rlhyrpagegkppvvllHGlggsseswrplapaLadgyrviapDlrGhGrSdppad.ysledladdll
00476831   1/1  --dlppveevtvttpdGvrlhyrlylPpgggplPvvvllHGgggssgswrplfrslaraLaerGyrvvap
00484601   1/1  --fkllllllllllltlllpplppppgvpveevtvptpdGvrlhyrlygPpgggplPvvvllHGggfvsg
00490371   1/1  --lrllepllypfeeryvtvpdGlrlhyreygppsgppvlllHGlggssesw.plapaLaeagyrviapD
00530451   1/1  --lPellslpgvtveevtvptpdgvrlplrlylPagpggklPvvvllHGgggssgsaswrplaralaarG
00481941   1/1  --gslllalllrllellkldlllellllllklellleplevefvdvdglrlhypppgggsgplpvvllHG
00533481   1/1  ----ery.pe.pgppvvllHGlggsaeswwlpsswrplaeaLaeaGyrviapdlrGhGgSdgpp..ysle
00502451   1/1  --asfsldldllllsysspttppelylfldllllellllplltlldpllfdlpgveveevtiptpdGvrl
00490871   1/1  ---PPyrpsgggpgppvvllHGgggsseswrplaealaerGyrviapdlrGhGgsdgpppdysledlaed
00473881   1/1  --allvpveevtvtvdglrlayrlygppggpklpvvlllHGlggsseswrplalaealaarGyrvvapdl
00479401   1/1  ---vgllsldldllllsysslttpsdlylfddlllaelelllltalllpelfdlpgveveevtiptpdGv
00476271   1/1  -Ggpdglr.ayllpgpgsgppvvllHGlggsaeswrplaraLagyrvvavdlrGh............edl
00462211   1/1  ---l.ppgagsgppvvllHGlggsseswlllgywrplaeaLaerGyrviapDlrGhGgSdgpp..ysled
00467931   1/1  -------tvdglrlpyrlylpaggggpkplvvllHGlggsgadwrplaralaeagfrvvapdypghgesp
00498871   1/1  -eevrteiltldglrlyyppgggklPvvvllHGgggsaeswrplaealaerGyrvvapdyrghgesdgpp
00372391   1/1  -----yrgdgegppvvlvHGlggsasswlldywrslaeaLaeaGyrviavdlrghGrs..P...ysledl
00445601   1/1  -----------gppvllvhGlggsssshwwrplaealasagyrvvaldlpghgls.......slddwved
00477641   1/1  -------lfdplllfdpevlldiselisklgypveevtvttedGltlplylylpptygelgggpkppvll
00486331   1/1  --------lpveevtipspdgdrlplrlylPagyapggklPvvvllHGgggsseswalfgrplaralaar
00489451   1/1  --dlpgvpveevtiptpdGvrlplrlylPagadpggklPvvvllHGgggssgspswrplaralaarlGya
00423391   1/1  ----------dgppvllvHGlggssyswrslaelLaaalpGyrvialdlrghGlsdkp.geysledlaad
00364431   1/1  --------agpapvvvllhglggssasfrplaralaarGyavlapdlrghglsggppdpalpldlgalla
00458241   1/1  --------MrlylylppgggplpvvvllHGgggsaeswrplaealaerlpgyvvvapdyrggplgflggl
00476001   1/1  --------gllllllalllaslpslpggtveevtvtspvdgdtlplrvylPagydpggplPvvvllHGgg
00473171   1/1  ------------HppvlllHGlggsaeswrplaealaeaGypdvrviapdlrghglsd....eysledla
00478791   1/1  -----ypgpgsgppvvlvHGlggssrswrpgldywlgpkdslaeaLakaGyrVialDlr.......p.sd
00480531   1/1  --pwsgvldllllllllllllllllllllllatkfgpacpqpvdlyppgvevedvtipspdgdprlplrl
00395261   1/1  ---mkllllllllallllstagpagvtvetvtipsdggrlpgrlylPagadagklPvvvllhGlggsaes
00476011   1/1  --------lgllPvgelRfkaPvplepwpacpqllslllpgllinkllekllrslldpepgvevedvtip
00400461   1/1  -gdsLlavrllarlplsllfdaptveelaalldsrlveadglrllvylpgggagpplvllHGggaggsaa
00502261   1/1  ------------dgmsepvtitseDglylnvtltlpeispgpkPvvvflHGGgfllgggsaesfrplara
00480031   1/1  ---------llnkyllfngkslpvfdtselirevvivedvlitmrdgvldrLaadiyrPkdtgklPvilt
00470341   1/1  -mkillillllllllllliglllrplsrllllpalenllfllytplnpeevrfvtvdgllrlhyylpgks
00466391   1/1  --------kpPvlaagagelrfkppepwsllgvldatllgplcpqllpppgvevedvtipgsdgrlplrl
00493831   1/1  ----------llpipalyvvelvffstvdgdklplrvylpkgklPvvvllhGgggssgsaswspygglae
00466241   1/1  -mkllllllllllllllllllllalllllpylpseldvrfllytlenpevrfitvdglrlyyppsgdgkk
00460121   1/1  -Kklllllllilllllplgtllfrlplllppppddldvrfllylnlnpeevtfvdvdglrlyypppgdgk
00480081   1/1  --------mklllllllllllllllasllqrpllllpssppeldvrlllytpeniesrdgdtlglrlyyp
00472201   1/1  -mkllllllllllllllllllllllllllpllppeldlrfllytlpleevrittedglrlhyrppgdgkg
00475921   1/1  ----lll.pgsgppvvlvHGlggsarswrpggdyWpglldslaeaLaeaGyrvialDl.GhGrS...gad
00518831   1/1  --------llellslkpvpggtlevltfkstalgrerrvlvylPpgypgggyPvlvllhGlggsgrswap
00466701   1/1  --sspggpvveesvtstvdgdrlplrvylPagagPvvvllHGgggsagspswrnygglaealaerGyivv
00491281   1/1  -----------alpvevetvtvpvdgdclhlvylPalPavvvllhGgggsagsaslelyrglaralaarG
00470031   1/1  --------rlpallalllllaallaslpappggtveevtipsrdgdrplrvylPagydpggklPvvvllH
00433261   1/1  --------melislllgfgglqkvyslaflrllvslpsapdgldvrfllytpdnpeigqllllldpllly
00510091   1/1  --------lllslgseasalsplvplrpgggsgpplflvhgagGsalvyrplaral.drpvyglqlpglg
00396021   1/1  --------ggplPvvvyiHGGgfvggsadlptydrlaralaaagyvvvsvdyRlaglsf.pehpfpaa..
00488251   1/1  --------lellsslkpfggvllkltvystadgrelsvyvylPpgalfsdsdpgkklPvlvllHGltgsa
00495911   1/1  -----------fetkslllrlpdgviitlvlykpedagdkskpvvlfihGgsggselpvyanlakdLvrq
00411931   1/1  --------ggkyPvvvllhGgggssgvpdsfsllplaqllasrGyvvvapdyrGsggsggafrdagpgnl
00370211   1/1  -------daggglPvvlvhGlggsssswlswgglvealakllpgirVysldlgglglsdvagsflanldd
00496381   1/1  --------Pislylydellllarlssaaycvydvdlplleplkcllnalplfpgfelvevllytddndtg
00463881   1/1  --------klaytletvsipldgvelyvllllpaglgrpViflnGlgsnlavttfeayaglakrlaekGy
00464121   1/1  ------sspvVttslGtvrGlllsltgggvyaFlGIPYAkpPvgelRFkpPqppepwsgvldatkygpac
00500101   1/1  --------llllplsitslelllllaklsdaayeelnglppglelievfvdvedglqgyvavdpdpkpvv
00509471   1/1  ------------------------------------GyvvvavdyrgsggsggafldagrgnlggveldD
00496371   1/1  --------distilynelellatlsdlaycvydayiylpnklncllnalkllkglelvlvfelvddkegg
00481261   1/1  ------sssspvvttslgtvrGlllsllgggvyaFlgIPYAkpPvgelRFkpPqppepwdgvldatkygp
00465021   1/1  --------dspvvttslgtvrGlllsllgggvyaFlgIPYAkpPvgelRFkpPqplepwdgvldateygp
00467291   1/1  ------edspvVttslgtvrGlllsllgggvyaFlgIPYAkpPvgelRFkpPqplepwsgvldatkygpa
00486751   1/1  --------pvvttslGtvrGlllsllgggvyaFlgIPYAkpPvgelRFkpPqplepwdgvldatkfgpac
00479741   1/1  --------eilgPtvidlelllllallslaaycddllllnplsclkkcpllpglelllvfvddesglqgy
00489351   1/1  --------sdpvvttslgtvrGllgggvyaFlgIPYAkpPvgelRFkpPvplepwdgvrdatkfgpacpq
00411281   1/1  -----------------------------------lgvvvvsvnYRlgplGflssgddehpgnag..leD
00496301   1/1  ------dspvVttslgtvrlGllgggvyaFlgIPYAkpPvgelRFkpPqplepwsgvldatkfgpacpql
00533361   1/1  --------dlrgissydketllllarlsaaaycdpkviktllelltlelpdgfellevfdddttglrgyv
00474511   1/2  --------apedllvtslpglpgdlgfkqysGyltvdegkslfywffesrgdpkgdPvllwlnGGPGcss
00474512   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LDEAKLSRPALVGLSNGGIVAMEAALLAPERFSALVLCCTTPYLDAALRAKVESWLHALKTGGTVLRLRV
00425511   1/1  dlgapysledlaadlaalldalgiervvlvGhSmGGaialllaarhpervaglvllapaaplealapall
00410811   1/1  pgegytlddladdlealldallglekvvlvGhSmGGalalayAaryPdrvkglvllgpagllplellall
00370131   1/1  kppggallgyslddladdlaalldalglekvvlvGhSmGGlvalalaaryPervkglvlldpapplllla
00501121   1/1  ledladdlaalldalglepvvlvGhSmGGlvalalaarygpervkglvllspplplllladallagllra
00462191   1/1  pdldladyslealaddlaalldalglgervvlvGhSmGGavalrlaarhPervaglvlldaagppllpap
00490941   1/1  aedlaalldallaglepvvlvGhSmGGlvalllaarlglapervaglvllspapplaalaalllrlllll
00458511   1/1  DlrGhGrSdgppdlgdysledladdlaalldalgiekvvlvGhSmGGllalalaaryPervkglvllspp
00465731   1/1  hGrSdgppspypysledladdlaalldalglepvvlvGhSmGGllalalaaryPervkglvllspplpls
00489821   1/1  gsseswrpltgpgpglaeaLaarGyrViapDlrGhGrStgpvsldpgtgkgyyvdatlplllllglglew
00459841   1/1  SdgpppdysledladdlaalldalgiepvvlvGhSmGGlvalalaaryPervkglvllspplplsalada
00482071   1/1  rplaeaLaarGkpldtdrvyrVvapDyrGhGgSdgpapeapytllgwgfsledlaeDlaaaldwlrenfg
00502061   1/1  hGrSdgppdfpdysledladdlaalldalgiekvvlvGhSmGGlialalaaryPervkglvllapappls
00460771   1/1  SdgppsleysledlvddlaadlealldalgidkvvlvGhSmGGlialalaarypervkglvllspalplp
00474951   1/1  papysledladdlaalldalgidgpvvlvGhSmGGllalalaarypervkglvllspplplsalapllla
00460041   1/1  sdysledladdlaalldalgiepvvlvGhSmGGlvalalaaryPelrvkglvllsppadlsaladallpl
00474441   1/1  ppgpdysledladdllalldalgiekvvlvGhSmGGlialalaarypervkglvllapalplsa....ll
00457361   1/1  ysledladdlaalldalgiekvvlvGhSmGGlialalaarylpervkglvllapplplllglppllglll
00464101   1/1  ddlaalldalgidepvvlvGhSmGGlvalalaarypervkglvllspplplllaslaalllallaallsl
00457421   1/1  ledladdlaalldalglepvvlvGhSmGGlvalaYlaarypervkglvllsppapladladplaglllar
00457411   1/1  ledladdlaalldalglepvvlvGhSmGGllvalalaarypervkglvllapplplsalalallllllaa
00471941   1/1  dysledladdlaalldalglepvvlvGhSmGAGlvalalaarypervkglvllsppapllllaellplgl
00496311   1/1  GghGrsdglppdysledlaeDlaalldalreqgpervvlvGhSmGGllalalaaryp..vkglvllsppl
00490011   1/1  gydwrklearlngfphftvevdglrihyreaGsknpdgppllllHGwpgssaewrpliplLadryalggl
00458861   1/1  aLaarGyrviapDlrGhGrSdgppspadysledladdlaalldalgiepvvlvGhSmGGllalalaaryP
00510011   1/1  aalldalgidekvvlvGhSmGGlialalaarypervkglvllapppplsaladallrllllallllllll
00472001   1/1  lgperglaeaLaerGyrVvapDlrGhGrStgpgflddgpgdpgdysledlaeaDlaaaidylldalgiek
00489651   1/1  dlaalldalgidekvvlvGhSmGGlialalaarypervkglvllapppplsalalallll.....lllel
00480751   1/1  alld....epvvlvGhSmGGlialalaarypervkglvllapapplldlaellarllkalaallalllll
00476831   1/1  DyrGhGgSggpp..ysgedladDlaaaldalrenlgidervvlvGhSmGGalalalaaryPdrvkglvll
00484601   1/1  vaalgsseswrplggnsaraLaarGyrVvapDyrGhGeSlgpegplslgddflggfgedaadDlaaaldw
00490371   1/1  lrGhGrSdgppdlgdysledlaadlaalldalgiekvvlvGhSmGGlialalaaryPervkglvllapal
00530451   1/1  yrvvapdyrggpehGfssgppgladggdllaedlaaaldwllengidprvvlvGhSmGGalalalalryp
00481941   1/1  gggssgspswrplaraLaagyrviapDlrGhGeSdgppdrlgpysledlaadllallrdalgidpvvlvG
00533481   1/1  dlaedlaalldalgiekvvlvGhSmGGlvalelaarypervkglvllapp....................
00502451   1/1  pyrlylPpggggklPvvvllHGgggsseswrp.araLaarGyrvvapDyrGhGrSsppaslngalgfasg
00490871   1/1  laalldallelgpekvvlvGhSmGGllalalaaryp..vkglvllspaldlsa.................
00473881   1/1  rGhGlSdgppsllpysledlaadlaalldalglervvlvGhSmGGllalllaarypervkglvllspald
00479401   1/1  rlhyrlylPdgggklPvvvllHGgggsseswrplaraLaarGyrvvapdyrGhGesggppadysledlgf
00476271   1/1  aadlaalldalgpdrPvvlvGhSmGGllalalaarleeypervaglvllspplplsalalal........
00462211   1/1  laedlaalldalgiekvvlvGhSmGGlvalalaarypervkglvllappldgsaladallellaaallal
00467931   1/1  npgaggrawfdilalspggpedeagledaaedlaalidallrlgidperivlvGfSmGGalalllalrlp
00498871   1/1  ddysledlaedllaaldwlreniavfggllllldpl.rvvlvGhSmGGalalalalrypd.vkalvllsp
00372391   1/1  aadlealldalgiekvvlvGHSmGGlvalyaaarrPdrvaslvllgpphlgspladllprllplllleal
00445601   1/1  llalldalg.epvvlvGhSlGglvalrlaarlpelarvaglvllapalplle..................
00477641   1/1  lHGlggsseswldlgperslaeaLaerGyrvvapdlrGhGgsagpyslgpapgepgdysledlavddlaa
00486331   1/1  aGyavvapdyrGhgesggppadagsgnlglldledlaaaldalldalgidpervvlvGhSmGGalalala
00489451   1/1  vvapdyrGhGesggpptpagaaysgedlaeDlaaaldwlrenfgidpdrvvlvGhSmGGalalalalryp
00423391   1/1  leallealg.ekvhlvGhSmGGlvaralaarlperkvkslvllapPhlgspladllpllllpdlllkl..
00364431   1/1  llaaysldalvedleaaldylraqpvdagkvglvGhSlGGalallla..apdrvkalvllagaldl....
00458241   1/1  qlfdllrghgespgpagllysledlaadllalldalaelgldpdriglvGhSmGGalalalaslrypdrf
00476001   1/1  gssgswslyrplaralaarliglgklpgyvvvapdyrGhgesggpaagndgeddaedllalldalirfgg
00473171   1/1  adlealldalglekvvlvGhSmGGlvalllaarlpaldrvaglvllsppl....................
00478791   1/1  ysledlaedlaylkgGtvdywdfsfdeiglydlpaaiealldalglelkvvlvGHSmGGlvalaaaarlg
00480531   1/1  ylPagpggklPvvvflHGGgflggsaeswrplaralaarlGyavvapdyrghgesggpaaledlaaaldw
00395261   1/1  yrglaralasrGyavvapDlrghgespgpp.vedllaaldyllallearlgvDpdriglvGhSmGGalal
00476011   1/1  tsdgrlylrlylPggplPvvvllHGGgflggsadswrplaralaarlGyavvapdyrghgesggpaaled
00400461   1/1  syrplaraLaagyrvvavdlpgygasepp..pysledlaadlaallralqgdgpvvlvGhSlGGllAlal
00502261   1/1  laarGllnvvvlvapdyrghgespgpag...ledlaaaldwlldnldpdrivlvGhSaGGalalalalry
00480031   1/1  yspygkdinaplldpkllsevelvtfktadGlelhgylylpaggkkpvvvllHGgpgssdrgsfrplaqy
00470341   1/1  gpvvvllHGgggssespywrplaeaLakrGdyrvvapDyr..Gr--------------------------
00466391   1/1  ylPagpggklPvvvflHGGgflggsaeswrplaralaarlGyavvapdyrghgesggpagledlaaaldw
00493831   1/1  alaergyivvapdyrgggegflwpsssgppgnfgledlldalaedlidlleaklgidpervalvGhSmGG
00466241   1/1  pvvvllHGgggsaespywrplaeaLakrGgyrvvapDyrGhGes--------------------------
00460121   1/1  kpvvvllHGgggssgspywrplaraLaerGgyrvvapDyrGhGe--------------------------
00480081   1/1  esgdgpkpvvvllHGgggsaespywrplaraLadrGdyrvvapD--------------------------
00472201   1/1  pvvvllHGgggsaespywrplaraLaerGgyrvvapDyrGhGes--------------------------
00475921   1/1  ysledladdlggfwdfsfdeiakyDlpalideaialldalglegkvilvGHSmGGlvalyaaarlpeegp
00518831   1/1  ralaqllaaglipgyivvapdlrgsggssapydpadafldflaeellplldalypvgadpdrvvlaGhSm
00466701   1/1  apdyRgggflrghgdsdgppgnfglldiedaladelidalidalgidpervalvGhSmGGllalalalry
00491281   1/1  yivvapdyrGfggsgpppadgnyglldqlaaaaldwlranlgidpgrvvlvGhSlGGalalllalryPdl
00470031   1/1  GgggssgsalssldswrplaealaarGdlppyrvvap...........pgpygledlaaaldwlldellg
00433261   1/1  rpgfngdrpvvvllHGlggsagsswwlplaralaarlgyn------------------------------
00510091   1/1  ....p..ltsleelaadyleairalqpegPyaLlGhSfGGlvAfelArqLeaageevPkvalLvlldspp
00396021   1/1  leDavaalrwlreniaafggdrvvlaGdSaGGnlalalalrlrdrglpprvaglvlispvldlpaalpse
00488251   1/1  eswlektglaellaelGyavvapdlrgsgesgrpfeddawdfgggagfyvnatedplakrgrmedylved
00495911   1/1  Gydvllvdyrgsgesdvp...lsledlaelleylvkligpskivliGhSlGGllallfalllprsnslvk
00411931   1/1  gpad..veDliaaldylralggvdpdriallGhSyGGylalalaarypdlfkaavalspvldl.......
00370211   1/1  qveavlalldnlpilaegvvlvGfSqGGlvaralaarlpepnvaslvllgsPhaGtaga-----------
00496381   1/1  lqgyvavdddnkpiviaihGtgsladwltdllllaegynviavdlrghggslgay---------------
00463881   1/1  iVllvd.yglsgsyddlpldatgepgrggfsildqdvkdlvellekltdvdlekiiliGhSlGgivalll
00464121   1/1  pqppslllplllglllllppvpgsEdclyLnvytPagalldlllllgllelPdgkvelldivlrdgdgip
00500101   1/1  vlfhGtgssadwltdlaaallpadlaegynv......Ghg...hsgflpsaedla---------------
00509471   1/1  lvaaldwlleqggvDpdriaifGhSyGGylalalalalldrypdrfkaavalapvtdlllydsgyleryl
00496371   1/1  lqgyvavdddkktiviafhGt....ssladwltdl.gfrvvavdlrghgks.hrg---------------
00481261   1/1  acpqllplllpdllgltvellvvpgsedclylnvytPaappsgklPvvvyiHGGgfvlgsassylylarr
00465021   1/1  acpqllsllldllpgvlvedlvipgsedclylnvytPagasgklPvvvyiHGGgfvlgsadshlylarrl
00467291   1/1  cpqlplllppllsglevedldvpgsedclylnvytPkappdgklPvvvyiHGGgfvlgsasshlylaral
00486751   1/1  pqllpllpplppgvlvedltipgsedclylnvytPagaggklPvvvyiHGGgfvlgsadsylylarrlaa
00479741   1/1  vavdddtkpivvafrGtgssadwltdlaaalvplgynvva------------------------------
00489351   1/1  lpplllvvlldvvygsedclylnvytPagpsgklPvvvyiHGGgfvlgsassydylaralaarggvvvvs
00411281   1/1  qvaalrwvreniaafGgDpdrvtlfGdSaGGalaallalsprdpglfkrailqsgsallpwallteeale
00496301   1/1  lllllllllllllllllllsllldllvltvllpvvpgsedclylnvytPagaapdgklPvvvyiHGGgfv
00533361   1/1  avdddtkeivvafrGt....asladwltdlg.fnvvavdlrgggk..vhrgflda---------------
00474511   1/2  lwglfgelgPfrvnldgltlvlnpyswnkvanllfiDq--------------------------------
00474512   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ALPWVFGRGFLEAHPELLAEEGLRGLAAQAPTKTAQERLLLGFLTLEDLRPRLKALALPALVLYGTEDLL
00425511   1/1  rllalllarlllptleallallallaallpllpeallrallrrllaldflgllfdpallaallealarpg
00410811   1/1  lllllllpallaallaallallladllaalllrllfpdallrdpelvaelledllrasglaaalalllll
00370131   1/1  lellrqllayllaqllrpptlaelllalpvglaallrrllrrlfadpsllseelvlallalllrpgalra
00501121   1/1  llaallalllaplllalrrllgllpallslpellealleylrddllradlrallallralrdadlleala
00462191   1/1  lplqlllllylllfllpllperlleaflrallrllfpsrlspelleayaalllrpgallrallalyrala
00490941   1/1  pllealla....lllaallrrllallfladldpellaalladllrlgaaalaallraldllaradllaal
00458511   1/1  lplsaladallllarqallpdllaallallpagllaalleallrllallaflsdealleallrllalyla
00465731   1/1  apldallealakllaslpdllfllggllelllplspaallrlladlplglaallaekfgrwlgfdvesll
00489821   1/1  sllrfdgppgdggaglvysledlaedlaalltdalrartgvllllanaeslgiglervvlvGhSmGGava
00459841   1/1  alllllllaallarllellgalspeellellarllladlldpelleaylrllladgalraalalyrllle
00482071   1/1  idpervvlvGhSmGGalalalaaryPdrvkglvllspaldllpldpallerlllallgdllaallallal
00502061   1/1  aladallrllaalllalpallfglgallelllaldplallralldllygddalllekfgrwlllenafsv
00460771   1/1  pllplllarllalllallleallelllrlllspdpltldpelleallrlllapgalaalaallrlllsal
00474951   1/1  llllllllellarllallgadpalldpelleallalllrpgalralaaly......ralldaleradlle
00460041   1/1  lllallldlllallaallaallerllallgldpllldeelleallalllapggldallaylrallalald
00474441   1/1  plllalllallpeallarllrllgadplllsdelleaylrpllrpdflrallalllalasaldlydadll
00457361   1/1  arllalllallgallaellrrlllslllplllsdelleelllallrdlllradlegllallralr..rad
00464101   1/1  lllllllallllllgllpallspeellayllallrpgflaaalallrglldalallaradllealakikv
00457421   1/1  llaallalllallpelllrlllelllpllladaelleallrylldlllradlrallallralara..dll
00457411   1/1  llalllalllallallaeallaalfgpllrddllldellellrdlllradlaallallral..arldlle
00471941   1/1  laallarllalllaglpelllrllallflpplllleelldellaalllpflraglrallralralll..d
00496311   1/1  dlsalalallrllllll............lppefledllalfdeelrdl............llgllrall
00490011   1/1  gfrviapDlpGyGfSdkppddagyslddladdlaalldaLgldgrvvlvGhSmGgavalrlaarhPervk
00458861   1/1  ervkglvllspplplsalapallrllaalllalllalllallrelllrlllllaallaglspellealla
00510011   1/1  lllyllllllllgglallltdpellalllalllagfarallallaglldalallaeadllealkkikvPv
00472001   1/1  vvlvGhSmGGllalalaaryPelgdrvkglvllsppldlsdlaepllallaalllllaallgllgallla
00489651   1/1  llalllalllallllllgadpslldeeelrallaallrpgdaeallallralrlalallaradllealkk
00480751   1/1  leallkrlllllllglllddelaelllallralgtadllallellralrradllealkkikvPvlvihGe
00476831   1/1  spaldl........llddlllpggapllplllalllgdlaalllallrllleallrllaallllspllad
00484601   1/1  lrenlgidpervvlvGhSmGGalalalaarlyPd.vkglvllspaldllpadlpsleralldallddllp
00490371   1/1  plseladwllrllakallepllllllalllalllallleallellladlllsddlaalllllllllsdlr
00530451   1/1  drvkalvllspaldlaallpsllelllllllllllll.................................
00481941   1/1  hSmGGllalalaarlaarypervkglvllsppldlse.................................
00533481   1/1  .............ldgspladallellrkallalllkllgllpe.lllllallrrldllealkkikvltt
00502451   1/1  gdfpaatlgdlggvenallrllaeDlaaaldwlrenfgidpervvlvGhSmGGalalalaarypd.vkal
00490871   1/1  .....lpllleallkrlldrllgdelldlllladplllarllldlladllalledllealakikvPvlii
00473881   1/1  llal..................................................................
00479401   1/1  yddeqakpyglhfpmvadDlaaaldwlrenfgidpervvlvGhSmGGalalala.rypdrvkglvllspa
00476271   1/1  .........................................rlppgllaallellraldllplelllagl
00462211   1/1  latllgalla.llllllllllldpelleallelllrpgplraalllyralddllaeadllealkkipkkv
00467931   1/1  drvaglvllsgalplaallp..................................................
00498871   1/1  aldllalllalllllll.....................................................
00372391   1/1  llalagllgallslllgpelllqilldalsdlttellaaflellpgsgflaallhgaqlvpgvrygsylr
00445601   1/1  .........................................glpellellkrldllellkklpvpvlvih
00477641   1/1  aldylrerlgiekvvlvGhSmGGllalaaaarlpelgervkglvllappldlsplaepllrlllalll..
00486331   1/1  lrypdrvkalvllspaldltalala.............................................
00489451   1/1  drvkalvllspaldllalllsllllll................lleallgllpellealraysplellkl
00423391   1/1  ..................................llllllteflqklvpagysrdpllvdlylessifla
00364431   1/1  .....................................................................d
00458241   1/1  kalvllspaldlldlllsllllll..............................................
00476001   1/1  dpdrvalvGhSmGGalalalalrypdrvkalvllspaldllalalallllal..................
00473171   1/1  .................................................lllllldllellakikvPvlv
00478791   1/1  pelveklivvdiapvlydgrlawypervkglvllapPhlGspladlll...........allpllallll
00480531   1/1  llenldalgidpdrvvlvGhSaGGalalalalrypdrglplvaalvllspvldl................
00395261   1/1  llaardpd.vkavvllapvldl................................................
00476011   1/1  laaaldwllenldalgidpdrvvlvGhSaGGalalalalrypdrglprvaalvllspaldll........
00400461   1/1  alrlrdrgervaglvlldpplpldp...............ealslldeellaallrlgglpp........
00502261   1/1  pdrglplllllldllsllsrvkalvlispvldllalllslll............................
00480031   1/1  laarGyavvavdyrGsggsggpfdnygpde.veDllavidwlvkrggaftgrtggkeakqpwdngkvgll
00470341   1/1  ----------------------------------------------------------------------
00466391   1/1  llenlaalgidpdrivlvGhSaGGalalalalrypdrglprvaalvllspvldlpa..............
00493831   1/1  llalalalrypdlfkgvillspaldlsdlals.....................................e
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00475921   1/1  eeiealgsggpklspllksypdrvkglvllapPhlGspladllrsllplllllpllaellrsllglllll
00518831   1/1  GGllAlylalryPerfagvvalsgslwpsdgplgdpealrey............................
00466701   1/1  Pdlfkalvllspaldl.....................................ladllpflerllkallg
00491281   1/1  vaglvllsgplpgsaaala.....................................elpeallallggld
00470031   1/1  iniaafgtlaerlllklgdpervdrvlvGhSmGGalalalalryPdrvkalvllspald...........
00433261   1/1  ----------------------------------------------------------------------
00510091   1/1  plllaallalrallalaelaallllllaallgllagldleelleallelggteerleallelllllg..l
00396021   1/1  lenlarrlaalaggplltlealarllrlylpdgadlddplasplla........................
00488251   1/1  lpalidalfpvlaerggidldrvaiaGhSmGGygAlalalrllypdrfkavvalspvvnp.sllpwgqka
00495911   1/1  gvvligpildgviplaaylgrl...............sllkdlkqpikslslehlledfleilesi....
00411931   1/1  .............llydtayterylglpllpedpealka..........................ysple
00370211   1/1  ----------------------------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------
00463881   1/1  alklpdriagvvlldPalnladerlslllgaiayileklglplllkevsnkvldrldldsli........
00464121   1/1  pggklPvvvyiHGGgfvlgsassylylaralaarlgvvvvsvdYRLgalGflas.apeapfplllealgn
00500101   1/1  ----------------------------------------------------------------------
00509471   1/1  glpeenpeayd................................................aysplehadkl
00496371   1/1  ----------------------------------------------------------------------
00481261   1/1  laarlgvvvvsvdYRLgalGflss.apehpfpgnagleDqlaalrwvreniaafGgDpdritlfGhSaGG
00465021   1/1  aarlgvvvvsvdYRLgalGflss.apehpfpgnagllDqlaalrwvreniaafggDpdritlaGhSaGGa
00467291   1/1  aarlgvvvvsvdYRLgalGfls------------------------------------------------
00486751   1/1  rlgvvvvsvdYRlgalGflssggapeapg..pagllDqlaalrwvreniaafggDpdritlfGhSaGGal
00479741   1/1  ----------------------------------------------------------------------
00489351   1/1  vdYRlaplGflssgdlsleapgpagleDalaalrwvreniaafggDpdritlaGhSaGGalalalalspr
00411281   1/1  lakalakllgcsgsddaellecLrsvpaeellaaqlkllllglllllpriagqvlfypvvdgdflpdspl
00496301   1/1  lGsadtydarrlaarlvelgkgvvvvsvdYRlgalGflsapehpfpapgNlgllDqlaalrwvreniaaf
00533361   1/1  ----------------------------------------------------------------------
00474511   1/2  ----------------------------------------------------------------------
00474512   2/2  --------------------------------------------vidllpallenpglrvlvysGdlDli


                         -         -         -         +         -         -         -:280
query           FPKAYASNLAEALRARLEALPAGHAAPIEAPLAFARAVRAFLEEVYA-----------------------
00425511   1/1  a.raslealrallral..aladlraalaritvPtLvihGedDpv--------------------------
00410811   1/1  yllllaalarldllerlakikvPtLiihGedDpvvp.egarela--------------------------
00370131   1/1  slrlyralllalaradllealakitvPtlviwGekDpivppel---------------------------
00501121   1/1  kikvPvlvihGedDplvppealaeelaealpnaelvvipgagHf--------------------------
00462191   1/1  lllllpllllaledlrealakitvPtlviwGedDpvvp.elaerl-------------------------
00490941   1/1  akikvPvlvihGedDplvppe.....erlpnaelvvipgagHllhle-----------------------
00458511   1/1  lltdpeallallealraglflrldygyllndllygsradlle----------------------------
00465731   1/1  dnqgsallddelldallrlllrpdfraalrllrallllaradl---------------------------
00489821   1/1  lllaaryPervkglvlls..pald....................--------------------------
00459841   1/1  aldlsdlalaradllealakikvPvlvihGedDplvppeaaeelae------------------------
00482071   1/1  llddlpealaallagllallllralaaalagllraldsldglpel-------------------------
00502061   1/1  elypaplsdelleallapllrpg..frallrflrallargdll---------------------------
00460771   1/1  dly.adllealkkikvPvlvihGedDplvppeaaeelaellpna--------------------------
00474951   1/1  alakikvPvlvihGedDplvppedaealaealpnaelvvipga---------------------------
00460041   1/1  llealakikvPvlvihGedDplvppeasaealaealpnaelvvi--------------------------
00474441   1/1  ealkkikvPvlvihGedDplvppeaaeelaellpnaelvvipgagHf-----------------------
00457361   1/1  llealkkikvPvliihGedDpvvppealaeelaellpnaelvvi--------------------------
00464101   1/1  PvlvihGedDplvppeaaeelaealpnaelvvipgagHflfleqpe------------------------
00457421   1/1  ealakikvPvlvihGedDplvppeaaealaealkpnaelvvipg--------------------------
00457411   1/1  alakikvPvlvihGedDplvppealaealaealpnaelvvipga--------------------------
00471941   1/1  lldllerlkaidvPvlvihGedDplvppealaeelaealpnael--------------------------
00496311   1/1  alaeadpledlakikvPvliihGedDplvppedaealaealpaag-------------------------
00490011   1/1  glvllsppgppptpaellpltleealalwyllffqlpelaeallq-------------------------
00458861   1/1  lllapgalradlallrallgfldlddyyrrasllealakikvPvlv------------------------
00510011   1/1  lvihGedDplvppeaaeelaellpnaelvvipgagHflfleapeev------------------------
00472001   1/1  llarallalllgdlllealvaellalllgldpalldllaldalla-------------------------
00489651   1/1  ikvPvlvihGedDplvppeaaeelaellpnaelvvipgagHflfle------------------------
00480751   1/1  dDplvppeaaeelaellpnaelvvipgagHflfleapeevaeail.fl----------------------
00476831   1/1  lsylrllalrllaafdnfllalllalrllddyyregdpledlaki-------------------------
00484601   1/1  llllrllladaallppelldallaslllldslaallrfdanaflg-------------------------
00490371   1/1  lspeallalldalsalslaraplngyrnalfyyeradllealkkikkv----------------------
00530451   1/1  ...........laallaldplellakikvPvliihGedDplvppedae----------------------
00481941   1/1  ........llesllrlllarlllddlleallgglladpellrdl--------------------------
00533481   1/1  egallfnakyPnggleapgsaeeglplellggngvlyyswsgts--------------------------
00502451   1/1  vllspaldls................................r---------------------------
00490871   1/1  hGedDplvppedaeelaealpgadvelvvipgagHflfleapree-------------------------
00473881   1/1  ......lealakikvPvlvihgedDplvppel..alaealpnael-------------------------
00479401   1/1  ldlaa...............lllpeallallrallldeflragl--------------------------
00476271   1/1  llklllldllywnldalakikvPvlvihgedDplvp.eaaea----------------------------
00462211   1/1  PvliihGeddplllsslllsgpdkdpvlvygdganlldlllllll-------------------------
00467931   1/1  ..................dllellaklkvPvllihGeaDpvvppe-------------------------
00498871   1/1  lalllaydplellkkiakvPvliihGedDplvppeeaealae----------------------------
00372391   1/1  llllnleldpladlrkikvPvllihgenDglvppesarlgfvlr--------------------------
00445601   1/1  gedDpvvpfelaerlaealgaelvvipgggHllllegpeevaellld-----------------------
00477641   1/1  .................fldgllgllgllpgellagalrllrpddls-----------------------
00486331   1/1  .lllleaglgllpellealraydplellakikavPvliihGedDplvpp---------------------
00489451   1/1  .....................lllakikvPpvliihGedDplvpp-------------------------
00423391   1/1  dlnnerallanleykenlsrl.vpvllihgenDgvvppessea---------------------------
00364431   1/1  pledlakikvPvliihGedDplvppelaealaealkagpdvell--------------------------
00458241   1/1  ........................kvPvliihGekDplvppee---------------------------
00476001   1/1  ...........................................---------------------------
00473171   1/1  ihgedDpvvppesa....llpnaelvvlpgagHllllenpeev.eli-----------------------
00478791   1/1  aallsfllrll.allsflpdldldllgllrllpetvrkflarl---------------------------
00480531   1/1  ...........eellpsyle.llggppldpelleafldlllgel--------------------------
00395261   1/1  ............................edlakikvPtlvihge--------------------------
00476011   1/1  ................alapslaellggdpllppellerlrallled-----------------------
00400461   1/1  ..........lrlllpalradlralpdyrl..ppldvPvlllvg--------------------------
00502261   1/1  ....................lrkflleylggdlaedlelllaasp-------------------------
00480031   1/1  GhSyGGylalllaarypdrlkalvllagvsdlyrdyrehggill--------------------------
00470341   1/1  ----------------------------------------------------------------------
00466391   1/1  sldlpslreladgpllppallerllgallgdpad.............-----------------------
00493831   1/1  llelllkelgekgvprllgnvyleylraydpldllkklakikppvliih---------------------
00466241   1/1  ----------------------------------------------------------------------
00460121   1/1  ----------------------------------------------------------------------
00480081   1/1  ----------------------------------------------------------------------
00472201   1/1  ----------------------------------------------------------------------
00475921   1/1  llldfdlallpllllslll............fldllrdfra.tdlleed---------------------
00518831   1/1  ...............................dplellaklkvpvll------------------------
00466701   1/1  ekglpaylgpivpeallaysplellkkliankppvllihGtnelgdl-----------------------
00491281   1/1  lelllgpvllgdllll------------------------------------------------------
00470031   1/1  ...........................................---------------------------
00433261   1/1  ----------------------------------------------------------------------
00510091   1/1  lldaellerllpvlradlralasyrppppldgpvllfraeedp---------------------------
00396021   1/1  ......lddllrglp.PtlivhgeaDplvp..ealalaaalraag-------------------------
00488251   1/1  fegylgddkeaweay.............................--------------------------
00495911   1/1  .........................pllilagdkDllvppkqslkla-----------------------
00411931   1/1  ladkikpppvllihGtaDdvvppeqsealadalkeagvpvellly-------------------------
00370211   1/1  ----------------------------------------------------------------------
00496381   1/1  ----------------------------------------------------------------------
00463881   1/1  .............................................-------------------------
00464121   1/1  agllDqvaalrwvre-------------------------------------------------------
00500101   1/1  ----------------------------------------------------------------------
00509471   1/1  kltplllihGtaDdvvppqqsealaaalkaagvpvellvypgegHg------------------------
00496371   1/1  ----------------------------------------------------------------------
00481261   1/1  alalalalsprdrgl-------------------------------------------------------
00465021   1/1  lalalalsprdpglfa------------------------------------------------------
00467291   1/1  ----------------------------------------------------------------------
00486751   1/1  alalalsprdpglfa-------------------------------------------------------
00479741   1/1  ----------------------------------------------------------------------
00489351   1/1  dpglfaaailispvld------------------------------------------------------
00411281   1/1  ellasgkfakvplliGvtsdEggpfltrellellldlylgdeaded------------------------
00496301   1/1  GgDpdritlaGdSaG-------------------------------------------------------
00533361   1/1  ----------------------------------------------------------------------
00474511   1/2  ----------------------------------------------------------------------
00474512   2/2  tpylgtelwiknlnwsgllgfrpwyvlllgsdgqvaGyvksygnltf-----------------------