[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80708.1


[Show Plain Result]

## Summary of Sequence Search
   1::421
   2::316  1.5e-90 41.6% 0035005 00350051 1/1    II aaRS and biotin synthetases         
   2::317  1.6e-85 37.7% 0040152 00401521 1/1    II aaRS and biotin synthetases         
   3::324  1.1e-68 40.3% 0048934 00489341 1/1    II aaRS and biotin synthetases         
   7::321  2.4e-63 40.7% 0051519 00515191 1/1    II aaRS and biotin synthetases         
   1::316  3.7e-62 35.7% 0050706 00507061 1/1    II aaRS and biotin synthetases         
  15::317  6.3e-61 40.3% 0049994 00499941 1/1    II aaRS and biotin synthetases         
   1::320  4.9e-60 35.1% 0046052 00460521 1/1    II aaRS and biotin synthetases         
   1::320  9.9e-60 32.6% 0046922 00469221 1/1    II aaRS and biotin synthetases         
   2::275  2.8e-59 32.8% 0046638 00466381 1/1    II aaRS and biotin synthetases         
   3::320  3.6e-59 34.4% 0048309 00483091 1/1    II aaRS and biotin synthetases         
   1::320  1.5e-52 34.6% 0045899 00458991 1/1    II aaRS and biotin synthetases         
   3::320  2.8e-52 38.7% 0048394 00483941 1/1    II aaRS and biotin synthetases         
   8::320  1.8e-50 36.1% 0046437 00464371 1/1    II aaRS and biotin synthetases         
   1::320    4e-49 31.6% 0046597 00465971 1/1    II aaRS and biotin synthetases         
   2::316  8.8e-42 33.0% 0042520 00425201 1/1    II aaRS and biotin synthetases         
  16::316  1.5e-38 29.9% 0045676 00456761 1/1    II aaRS and biotin synthetases         
   6::224  1.1e-37 32.3% 0047165 00471651 1/1    II aaRS and biotin synthetases         
   3::209  1.5e-33 32.2% 0041634 00416341 1/1    II aaRS and biotin synthetases         
   4::321  1.7e-31 27.3% 0035194 00351941 1/1    II aaRS and biotin synthetases         
   4::175  1.6e-28 34.7% 0041426 00414261 1/1    II aaRS and biotin synthetases         
   4::316  1.5e-27 27.5% 0035382 00353821 1/1    II aaRS and biotin synthetases         
   3::317  1.3e-24 27.6% 0041422 00414221 1/1    II aaRS and biotin synthetases         
 326::421  3.3e-22 48.4% 0035004 00350041 1/1    II aaRS ABD-related                    
  11::316  7.8e-19 22.3% 0035444 00354441 1/1    II aaRS and biotin synthetases         
 326::420  4.2e-18 45.3% 0040151 00401511 1/1    II aaRS ABD-related                    
 326::421  1.3e-14 40.6% 0050705 00507051 1/1    II aaRS ABD-related                    
 325::418  3.8e-14 37.4% 0042728 00427281 1/1    II aaRS ABD-related                    
   7::165  8.6e-13 29.9% 0049378 00493781 1/1    II aaRS and biotin synthetases         
 317::420  1.9e-12 33.7% 0041631 00416311 1/1    II aaRS ABD-related                    
 319::420  4.4e-12 33.3% 0041420 00414201 1/1    II aaRS ABD-related                    
 323::420  1.2e-11 31.6% 0037214 00372141 1/1    II aaRS ABD-related                    
 318::421  1.1e-10 33.7% 0037946 00379461 1/1    II aaRS ABD-related                    
 330::422  2.5e-10 33.3% 0035193 00351931 1/1    II aaRS ABD-related                    
 319::421  1.7e-08 33.0% 0041424 00414241 1/1    II aaRS ABD-related                    
 319::420  6.1e-08 30.7% 0038521 00385211 1/1    II aaRS ABD-related                    
 318::421    2e-07 31.7% 0052834 00528341 1/1    II aaRS ABD-related                    
  17::216  5.9e-06 21.4% 0042525 00425251 1/1    II aaRS and biotin synthetases         
   1::421


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
00350051   1/1  -iiqlpkgtrdllpaglrlrrkieniirevferyGylevetPilepaelllgslggrldhygkemfrlkd
00401521   1/1  -irqlpkGtrdylplglrlrrkieeiirevfrryGyqevltPilepaelllrsagghwdiygkemyrfkd
00489341   1/1  --irqlvsGlydllplglrlrrkieniireffeerGflevetPilepaelleesaghlldkfakelftvt
00515191   1/1  ------yllPkGlrdllplglrlrskieniireffdkrGflevetPilepaelllrwegaghllvgkelf
00507061   1/1  gmirqlpsGlydwlplglrlrrkiediireffderGflevetPilepaellkesgge..difge.mftft
00499941   1/1  --------------lglrlrskied.irevfdrygflevetPilepaellgas.............dfld
00460521   1/1  llPlpikklvslelrlryryldgrrdllpailrvrskiesaireffdergflevetPilepaell.....
00469221   1/1  tlpllldlellpldkklvslelrlryryldgrrdllpailrvrskieraireffdergflevetPi....
00466381   1/1  -kdhvelgkrlglfdiyggvkGlydllplgarlrraleniirevlvrygyqevltPilepaell.kasgh
00483091   1/1  --lryldgrrdllpailrlrskiisaireffeeygflevetPilepseleg..........akelf.ftd
00458991   1/1  plPlkikgdvelslelrlryryldlrrdllpailrlrskiisairefleergflevetPilepsel....
00483941   1/1  --nrldlgtndllpl.lrlrskiesaireffdeygflev.tPlilepaedllflrgggarld..gkel..
00464371   1/1  -------slelrlryryldlgrrdllpailrlrskiisaireffeergflevetPi.....Ltkssgeg.
00465971   1/1  aleilvlskaelplypldkklvslelrlryryldlrrdllpailrlrskiisairefleergflevetPi
00425201   1/1  -kidvllgrrdllpgglhprskvieaireiflslgflevetPilesaesnfdallfpvdhpardlqdtfy
00456761   1/1  ---------------alklrseviraireffeerlakelgfvevetPilvstel...glgdnldgvekpv
00471651   1/1  -----kvlkpleedferdhvelgkrlglidfqgvsGfydllplgarlrralenfirevlleygylevltP
00416341   1/1  --dhrelgkrlglidfereagsGlydllPlgarlrrklenfireelvklgyqevltPilvpaelleks..
00351941   1/1  ---ltlkeealvalhkrrgfllrafeiygglsGlydylPlglrlknkleniwreefvllregylevdtPi
00414261   1/1  ---lsvsGlydllPlgarlrraieniireeldelgylevltPilvpaellekesgh.legfgdelfrvtd
00353821   1/1  ---ltlkleplvellkrrglllrageiygggsGlydylPlglrllnkleniwreelvllregylevdtPi
00414221   1/1  --dakrdhrelglrlglidfrlsgsGfyvllplgarlrralenfireell.lgyqevltPllvpaellwk
00350041   1/1  ----------------------------------------------------------------------
00354441   1/1  ----------dletrlryryldlrtndllrailrlrskiiraireffdergflevetPiltssdg.....
00401511   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00493781   1/1  ------vgtefdnvellkvglkrledaekrdhvelgkrlglidesaekvsgsGlyvllplgarllralen
00416311   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------lhplqkllrrlreilaglGftEvitfsllslelahparlmq.d....tvyllnP


                         -         -         *         -         -         -         -:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
00350051   1/1  rggrelaLrpdltppvarllaqnllsykelplrlyyigpvFRdErpglgrlreftqvdaeifgadsedad
00401521   1/1  rggrelaLrpdltppiarlfa.ellsyrdlplrlyyigpvFRdErpglgrlreftqldaeifgadsedad
00489341   1/1  drggrelaLrpelTaevarlllknllvsgrdlPlrlyqigpvFRnErpragRvreFtqleaeifgadsed
00515191   1/1  tftdrggrelaLrpeltpqlarlllrsgr...dlPlrlyqigpvFRdErpglgRlreFtqldaeifgads
00507061   1/1  drggrelaLrPettpqlarklllrsgr..dlPlrlyqigpvFRnErpgagRlrEFtqldaeifgadeeda
00499941   1/1  rsgrelaLrpdltpplarlllmsyr...dlplrlyqigpvfRdErp..grvref.qldaeifgeddlaad
00460521   1/1  ...ga.gkelftfkdrggrdlaLrpspelylarllagg.ld......rvyqigpvFRdErprtgrlrEFt
00469221   1/1  .Ltkssgeg....agkelfrfkdrggrelaLrpspelylkrllaag.ld......rvyqigpvFRdErpr
00466381   1/1  l.dgfgdemykf.drggrdlaLrPtsevpiarlfaneilsyrdlPlrlyqigpvFRnEarprlrGllRvr
00483091   1/1  rggrdlyLrpspely.krllaag.lg......rvyqigpvFRdErpqtgrhlrEFtqldaemagvadled
00458991   1/1  .egaadlfvk......drlgrdlyLrpspelylkrllvgg.ld......rvyqigpvFRdErprtgrHlr
00483941   1/1  ..drlgrdlyLrpspelylkrllagg.lg......kvyqigpvFRdErpqsgrlrhlpEFtqldaemaga
00464371   1/1  ...vakelftfsdrfgrdlyLrpspelylkrllagg.ld......rvyqigpvFRdErpgarrlrEFtql
00465971   1/1  .....Ltkssgegaadlfvk......drlgrdlyLrqspqlylkrllag.gfd......rvyqigpvFRd
00425201   1/1  lggavakelytfkdyfgrdllLrthttlvlarllasllk.....PlrvfeigpvFRaErsdathlpeFhq
00456761   1/1  lfdlkdyggeelyLrqslql.ykrlllanygl...gkgegvytigpvfRaEepqldrrHlreftqldaEl
00471651   1/1  ileptellwkesghledf.gdemykftdrggrdleeplyLrPtsevgitrlfanlilsyrdlPlrlyqig
00416341   1/1  ghldkfgeemfkltkdregrdlyLrPtaepgitrlfadellsyrdlPlrlyqigtvfRnEasgrgrGLlR
00351941   1/1  llpaelwkaSghl..dkfgdelyklkdrggrfradhlleelleklleellldlelkkeleslllellgls
00414261   1/1  rggnalgrelaLrptselpltrlfrdeilsyrdlPlrlyqigpvFRnEgrptrgLlRvreFtqmkvehff
00353821   1/1  llpaelwkaSghl..difgdelyklkdrkglseprefnlmfetllgPtheevltlllrpetaqgifvnfk
00414221   1/1  esghl.egfgdelfkvtklgkdregddlyLrPtsevpitrlfadeilsyrdlPlrlyqigtvfRnEarpt
00350041   1/1  ----------------------------------------------------------------------
00354441   1/1  ....eggarlflvpldyfgkdlyLrqspqlylkrllaggfe.......rvyeigpvFRnEdsdarHlpeF
00401511   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00493781   1/1  fireelvelgylevltPilvpaellea..sghldkfgdelfkveded...lyLrPTaeviltnlfrdeil
00416311   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00425251   1/1  lseersvLRtsllpgllralaynlnrglklPirlfeigrvfrndeplvlaghlrgfhqleglv..vdkdv


                         +         -         -         -         -         *         -:210
query           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKS
00350051   1/1  aeliallleilkrlglkdvrlelnslgilealleylglllsaefallealdeddivrleavplgildeka
00401521   1/1  aevlallleilkrlgleddvtlklnhrglleavlaylgllgdllsrlfdvldklgedrleknllrildfk
00489341   1/1  adaevldllleilkelglpyvvvelgtgdileeflalydvledalrallealdlanieglgafylkkldi
00515191   1/1  edadaevedllleilkelglkyvvvrlsdrgalggllevlgdarealielldklglalliellelglfvg
00507061   1/1  daevldllleilkrlglpdfvrlrlntrpilglgsdefdleagealiealdklglaanievldalygpkl
00499941   1/1  aeviallleilkelglkdltlklnhrglldallggldkpdlralleal.dkldlldldsvlgllanplpl
00460521   1/1  qldaemagadye....elldlleellkalglkifeirlnpfk....rltyaealeilgsdspdlrllede
00469221   1/1  tgRhrEFtqldaemagadyedldaeleallkellkailg........idlglpfirityrealeilledk
00466381   1/1  eFtqveaeifgtpeqaldelaellalaleilerlglpyrvvrlntgdlgfagdlefwlpaeaglre.ils
00483091   1/1  daellelllrllfklglgdfvlelnlrgillgvlglpfprltylealdklllgllveldldlgklldall
00458991   1/1  EFtqldaemagvadledlmelieellkeilkal.lgdlklelnslgilegileygfllltyeelielldk
00483941   1/1  dledlmaeleallaellkailgllgleleifgritlsealeflg..........................
00464371   1/1  daemagadyedlmaeleallrdllkal.lgdlklelnglgidllrplerlgliekllkvlgaldkldrlg
00465971   1/1  ErprtgrhlrEFtqldaemagaddledlmellelllrllfklvlgdltlelnrlgylealleyggvlgad
00425201   1/1  legevagad..lslaeliglleellkelf.........................................
00456761   1/1  vgadsedllaeleelvvdilkalglteklllklfgllkvlpdpfprityeeaidkldklgpkeregellk
00471651   1/1  pvfRnEasprgLlRvreFtqveaheifgtpeqaadeleelldlaleilerlglepyrvvlntrgdlgaya
00416341   1/1  vreFtqvdahifgdpeqaeeeleelldlyleilkrlglpyrvlrlstgdiggsakytgdievwlpaeng-
00351941   1/1  leelkelieeydikcPlcgekgdlteprpFnlmfdtllgPtaeevltlylrpetaqgifvnfknllllsy
00414261   1/1  hadpedaeeeleelldlyeeileelglpyrvvrld-----------------------------------
00353821   1/1  nllllsykklPlrlaqigkkFRnEirPrnGLlRvreFtqkeaesFvlpedaletyeymlaaylrilkklg
00414221   1/1  rgllRvreFtsqveahifhvtpedadeeleelldlyeeilkrlglpyrvvrlstgd..............
00350041   1/1  ----------------------------------------------------------------------
00354441   1/1  tqlelemafadyedlmdlleellkyvlkallgnllvelelleidlte............pfprityaeai
00401511   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00493781   1/1  syrdlPlrlaqigtcfRnEassaGr---------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00425251   1/1  dfadlkglleallealgl.evrfrpsefpflhpgreadillggleiGgiGelhPevlealgldpvfafel


                         -         -         -         +         -         -         -:280
query           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
00350051   1/1  egllellellgagslleklleealgrleqlleylkalgvpvrldlslvrgldyytgvvFellargigvgg
00401521   1/1  rggyaevlekaeall..dpllaealeeleallealealgievvidpglvrgldyytglvFevylpgievg
00489341   1/1  kvedalgllatln..tildaldfellerlelyvdgleaagvpvlldpalvrgldyytgivfelyakalea
00515191   1/1  plliallkdvldrpllvleqapli.lldfllp...erfellvaglellnvgypvlidpslvrgleyytgi
00507061   1/1  ldelldaldelvglptflldfplplspla....evlerfelvlaglelaggspelidpslqrgleyytgi
00499941   1/1  ldlkggdalgldrla..plltdqldfealerlealleylgalgiklpvvidlalvrgldyytgivfeiya
00460521   1/1  ldrlelldlllleliee.......kllvdpvfitdypeeisplyklldlldalaerfdllvpglelvrgs
00469221   1/1  pdllfdleldlldlldllllelieeelgkllpvfvtd..ypkl.kplymlleddpdllleafdl.lvngl
00466381   1/1  alncddfqalglnalygldidfelkdelvrtl..ngttlaldrlllailelnyqgedgslviPvv-----
00483091   1/1  lrlleeklgsgpvfltdapa..lldalyllsd...........dpgvaerfdl.lvrglEyytgsirehd
00458991   1/1  ldkdslerlelgalllllleelledkllkd..pvfitdy..pleikpfy.llklldapgvaerfdl.lvr
00483941   1/1  .....................lldelveellelfepvfvtdyplafyapddprlvrgldlytpgtvfEla
00464371   1/1  leeaiellrelglkvevakelg..alllelleelveeklghpvfvtdypaelsplymplpldpdllerfD
00465971   1/1  flrlt...yeeaidlldknglevldvkdlgllllllle..elledklghdpvfltdypaelkplyklldp
00425201   1/1  ........................................gelvevrlrppyfpftepsfevfvygyelg
00456761   1/1  elgavflrilgrklsd...glghpvflpdyplllkpfymkldglngdl.lesfdlllnglelvsglirvt
00471651   1/1  gpkidfevllplgr--------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------
00351941   1/1  kklPlrlaqigkkFRnEirPrnGLlRvReFtqkeaesFvlpedaletyeymlalylrilkklglppenlr
00414261   1/1  ----------------------------------------------------------------------
00353821   1/1  lpyrvlrlrev.ladegahygsksidfevlfpagedelvgcsnrtdydlrehalgsgedlvtilllaelk
00414221   1/1  ......................................................................
00350041   1/1  ----------------------------------------------------------------------
00354441   1/1  ellggdkpdlrldlellllalakelgvkveiklglgdllselferlleeklgdptfvtdfPleispfymp
00401511   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00425251   1/1  glerll----------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
00350051   1/1  aiagGgrYdglleafgggpvpavGfglgleRllall----------------------------------
00401521   1/1  heiagGgrYdglldalggkplpavGfgigldrllall---------------------------------
00489341   1/1  lgleaavadggrYddllealgggappavGfalgldrLvllleae--------------------------
00515191   1/1  vfeayagglga..alagggrYdgllealgyg.ppavGfalg-----------------------------
00507061   1/1  vfelyakglgag.svaaggrYddlldalggglppav----------------------------------
00499941   1/1  gglg..galagGGrY.......ggkdvpavGfslgle---------------------------------
00460521   1/1  lryydgivlearfkelg.lgdveaggryddlldalgyglp------------------------------
00469221   1/1  elvrGslryydgivlearfkelgl.gtveaggryddllda------------------------------
00466381   1/1  ----------------------------------------------------------------------
00483091   1/1  lelllerfgaqglgggryddllealgyglpphgGfgiGld------------------------------
00458991   1/1  glElyngsirevdpeelgarfeilgggeeryddlldalgy------------------------------
00483941   1/1  sgslrlhdpeelgarfklggggaeryddlldalgygelpp------------------------------
00464371   1/1  llvrglElyngsirlhdfelqlerleeqgsilgggrydgl------------------------------
00465971   1/1  ldpdlaerfdllvrglElyngsirehdpeelgarfeilgg------------------------------
00425201   1/1  dwfevlgcglllpevleaaggdydylvallyglppp----------------------------------
00456761   1/1  dlvleaqlkllg......dggrydlglleallygel----------------------------------
00471651   1/1  ----------------------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------
00351941   1/1  frlv.ladelahyasdswdfevlfpfgldelvgcanrtdyd-----------------------------
00414261   1/1  ----------------------------------------------------------------------
00353821   1/1  evltley.............................----------------------------------
00414221   1/1  .......lgegasygydieawlpd.gryievgtisql---------------------------------
00350041   1/1  ---------------------------------------------lapvdvyvvplgeealeyalklaek
00354441   1/1  lpedpglaerfDllvnglElaggsirlhdpellrer----------------------------------
00401511   1/1  ---------------------------------------------lapvdvyvvplgeealeyalklaee
00507051   1/1  ---------------------------------------------laPvqvvvvplgeealeyalelaee
00427281   1/1  --------------------------------------------wlaPvqvvviplgeealeyalklaee
00493781   1/1  ----------------------------------------------------------------------
00416311   1/1  ------------------------------------ddyglvlPpwlaPvqvvvvplgdeelleyalela
00414201   1/1  --------------------------------------yglvlPpwlAPvqvvviplglkdseeelleya
00372141   1/1  ------------------------------------------fPpwlaPvqvvvvpigeelleyalelak
00379461   1/1  -------------------------------------rvvlklppalaPvkvavlplglkkeellelale
00351931   1/1  -------------------------------------------------qvvviplllkdeelleyaekl
00414241   1/1  --------------------------------------yglvlPpwlAPvqvvvipislkdsleelleya
00385211   1/1  --------------------------------------yglvlPpwlAPvqvvvipislkdseeelleya
00528341   1/1  -------------------------------------rtvlilppalAPikvailplslkkeellelaee
00425251   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
00350051   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------
00458991   1/1  ----------------------------------------------------------------------
00483941   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00465971   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00456761   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00350041   1/1  LrdgirveldlsgeklkkqlkradklgapfaviiGedelesgtvtlkdldtgeqvtvsldelvellkell
00354441   1/1  ----------------------------------------------------------------------
00401511   1/1  LraalpgirvelddsgrslgkqlkradkigapfaviiGedeledgtvtlkdldtgeqvtvpldelvellk
00507051   1/1  LraagirveldlrgeklgkklkeadligapyalviGekelengtvtvkdrdtgeqetvsldelvelllel
00427281   1/1  lrdagirveldlrgeklgkkikdadligipyvlvvGekelengtvtvknrdtgeqetvsldelvellk--
00493781   1/1  ----------------------------------------------------------------------
00416311   1/1  eeLraagirvelddrgeslgkkirdadligipyvlvvGekelengtvtvrdrdtgeqvtvsldelvellk
00414201   1/1  eelakeLraagirvllddrneslgkkfrdadligipyrlvvGdkeledgtvtvrrrdtgeqvtvsldelv
00372141   1/1  eLraagirvelddrneslgkkirdadligipyvlvvGdkelengtvtvrrrdtgeqvtvsldelvellke
00379461   1/1  lyneLreagisvlydykedsdgsigkryaradeigipfavtigedelengtvtvrdrdtgeqervkidel
00351931   1/1  aaeLraagirvllddrdesigkkfrradligvpfrivvGekeleegedaaeeedgtvtvrdrdtgeqerv
00414241   1/1  eelakeLragirvllddrnesigkkirdaeligiPlrivvGdkeledgtvtvrrrdtgeqvrvsldelve
00385211   1/1  eelakeLraagirvllddrdelsigkkirdadligvPyrlvvGdkeledgtvtvrrrdt.eqetvsldel
00528341   1/1  lyneLrkagisvllddleddsgsigkryaradeigipfritigedtlengtvtlrdrdtmeqervsidel
00425251   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           G---------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00483091   1/1  ----------------------------------------------------------------------
00458991   1/1  ----------------------------------------------------------------------
00483941   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------
00465971   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00456761   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00350041   1/1  s---------------------------------------------------------------------
00354441   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00507051   1/1  l---------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00379461   1/1  v---------------------------------------------------------------------
00351931   1/1  sl--------------------------------------------------------------------
00414241   1/1  l---------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00528341   1/1  v---------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------