[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80739.1


[Show Plain Result]

## Summary of Sequence Search
   1::342
   8::338  2.9e-73 46.3% 0040409 00404091 1/1   ransporter involved in vitamin B12 upta 
   1::342


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTRALPPALARGLVFLWLVALLLGAVALGVGLGAVAVPPEAVVRALLGLEENPIVTELRLPRVLAGVLVG
00404091   1/1  -------kellllrlrrrllllllllllllllllllslllgavlislsdvl....dsllllilldlrlpr


                         -         -         *         -         -         -         -:140
query           AALGVSGAAFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFVGAL
00404091   1/1  llaallvGaalavaGallqtltrNpLadPsilGissgallgavlailllpgvalalll...........p


                         +         -         -         -         -         *         -:210
query           SATLLTLVLAGGVARTGELVLAGVVVGSVLTGLTTYLMMQDADRVRAVFAYTLGNLAFAGWEGVRVLALF
00404091   1/1  laaflgallaallvallargglsplrllliGialsallsalltllllladpealqsllfwlfGsllgvsw


                         -         -         -         +         -         -         -:280
query           FALAFPPLLFLGRVLNALGLGEETARSLGLPLEALKLLLLGAASLLTASAVAQAGIIGFVGLVTPHLLRR
00404091   1/1  sdlllllpl.llvlllllllarplnllslgeelArslGvnvrrlrllllllvallvaaavalvGpilfvG


                         -         *         -         -         -         -         +:350
query           LLGEDYRLLLPASALGGGALLALADLLARTLARPAELPVGVVTTLLGGPFFLYLMWRRRGRA--------
00404091   1/1  LlvPhlarllvgsdhrlllplsallGallllladllgrllllplelpvgvvtaligap------------