[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80786.1


[Show Plain Result]

## Summary of Sequence Search
   1::177
  81::157    9e-26 64.9% 0049556 00495561 1/1   ed helix" DNA-binding domain            
   2::81   7.6e-12 40.0% 0049555 00495551 1/1   ed helix" DNA-binding domain            
   1::177


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERVAGGWRLVVHP
00495561   1/1  ----------------------------------------------------------------------
00495551   1/1  -pelsllelkriiEAlLfvagePlsleeLaellgegldeeeveealeeLaeeyeedgrglelvevaggyr


                         -         -         *         -         -         -         -:140
query           KALEAVERVLKPSPPRLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPG
00495561   1/1  ----------ellplklsqaaletLaiiaykqPvtraeieeirGvdsdgvlktLlerglieevgrkeepg
00495551   1/1  lqtrpelaell-----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RPKLYGTTERFLEVFGLESLEDLPPLREDGPPLLLRG---------------------------------
00495561   1/1  rpllygttekFlelfgl-----------------------------------------------------
00495551   1/1  ----------------------------------------------------------------------