[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80787.1


[Show Plain Result]

## Summary of Sequence Search
   1::195
   2::181  1.1e-41 45.0% 0038693 00386931 1/1   RibB                                    
   9::197  1.1e-41 46.2% 0039486 00394861 1/1   RibB                                    
   9::191  2.3e-41 46.7% 0039944 00399441 1/1   RibB                                    
   1::195


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MERVYQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
00386931   1/1  -enllldlleqaaelLkeggvvalPTetvygLgadalneeAverlralKgrpldkplillvsdleqllkl
00394861   1/1  --------aqplacppcgpqlrlleeaaelLkeggvvalPTetvygLgadalneeAverlralKgrpldk
00399441   1/1  --------haqplaippcgpqlrlleeaaelLkeggvvalPTetvYgLgadalneeAverlralKgrpld


                         -         -         *         -         -         -         -:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKS
00386931   1/1  allseleelalrlleafwPgPltlilpakkelpklltpgldtvgvrlPdhplalaLlellglpLvatSan
00394861   1/1  plillvsdleqllelal...lselalkllkafwPgpltlilpakkelpklltpgldtvgvrlPdhplala
00399441   1/1  kplillvsdleqllelal...lselalrllkafwPgPltlilpakklvpallltpgldtvgvrlPdhpla


                         +         -         -         -         -         *         -:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGAIPKEALLAHLR---------------
00386931   1/1  lsgepsltdaeevlellgglvdlildggilvglpstvvdlt-----------------------------
00394861   1/1  Ll..lggplvatSAnlsgepsltdaeevlerlggvdlildggpilvglpstvvdltg-------------
00399441   1/1  laLlellglplvatSAnlsgepsaltdaeevlerlggivdlildggrligl-------------------