[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80819.1


[Show Plain Result]

## Summary of Sequence Search
   1::211
  22::205  1.1e-41 38.6% 0051503 00515031 1/1   edoxin-like                             
  28::209  6.8e-39 32.2% 0035499 00354991 1/1   edoxin-like                             
  28::209  4.2e-38 35.0% 0037799 00377991 1/1   edoxin-like                             
  40::209  6.8e-38 37.7% 0049102 00491021 1/1   edoxin-like                             
   9::205  1.6e-32 37.8% 0044619 00446191 1/1   edoxin-like                             
  20::213  8.2e-27 35.1% 0036937 00369371 1/1   edoxin-like                             
  21::207  5.1e-26 31.1% 0043845 00438451 1/1   edoxin-like                             
   8::127  2.6e-18 28.8% 0044455 00444551 1/2   edoxin-like                             
  44::207  1.4e-12 36.1% 0037704 00377041 1/1   edoxin-like                             
  19::206  7.2e-10 27.8% 0051923 00519231 1/1   edoxin-like                             
  29::208  5.5e-09 32.0% 0039301 00393011 1/1   edoxin-like                             
 130::204  5.9e-09 36.0% 0044455 00444552 2/2   edoxin-like                             
  30::208  2.6e-08 31.0% 0045740 00457401 1/1   edoxin-like                             
  43::205  4.5e-08 34.5% 0051595 00515951 1/1   edoxin-like                             
  31::205  2.2e-07 29.8% 0038800 00388001 1/1   edoxin-like                             
  29::208  3.6e-06 29.0% 0049048 00490481 1/1   edoxin-like                             
  24::209  5.8e-06 28.2% 0052451 00524511 1/1   edoxin-like                             
  45::211  7.9e-06 32.1% 0048363 00483631 1/1   edoxin-like                             
  20::209    1e-05 25.7% 0049089 00490891 1/1   edoxin-like                             
  27::210    1e-05 27.5% 0046603 00466031 1/1   edoxin-like                             
  24::209  1.1e-05 27.0% 0049857 00498571 1/1   edoxin-like                             
  18::209  2.2e-05 22.5% 0041722 00417221 1/1   edoxin-like                             
  30::208  3.6e-05 27.1% 0049496 00494961 1/1   edoxin-like                             
  17::208  5.7e-05 26.6% 0050950 00509501 1/1   edoxin-like                             
  30::211  8.3e-05 25.2% 0045739 00457391 1/1   edoxin-like                             
  33::207    9e-05 27.7% 0051129 00511291 1/1   edoxin-like                             
  15::206  0.00013 30.5% 0050108 00501081 1/1   edoxin-like                             
  19::209  0.00013 25.9% 0051914 00519141 1/1   edoxin-like                             
  28::208  0.00021 27.7% 0046295 00462951 1/1   edoxin-like                             
  24::207  0.00029 26.7% 0039300 00393001 1/1   edoxin-like                             
  35::210  0.00033 28.9% 0049377 00493771 1/1   edoxin-like                             
  24::212  0.00034 27.3% 0048146 00481461 1/1   edoxin-like                             
  33::208  0.00043 26.6% 0046982 00469821 1/1   edoxin-like                             
  35::209  0.00044 30.0% 0049633 00496331 1/1   edoxin-like                             
  43::207  0.00044 29.4% 0037474 00374741 1/1   edoxin-like                             
  43::208  0.00049 30.2% 0049632 00496321 1/1   edoxin-like                             
   1::64    0.0092 29.7% 0039527 00395271 1/2   edoxin-like                             
 168::207    0.084 37.5% 0039527 00395272 2/2   edoxin-like                             
   1::211


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPRAIVLVVLGLALLGLGWILWGPKGKAGLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPR
00515031   1/1  ---------------------lllslllaalleddgdpvlGnpdapvtiveFfdynCPyCakfepelep.
00354991   1/1  ---------------------------vellegkdfdvvlgsasgkpvlveFfapwCphCkala.pvlee
00377991   1/1  ---------------------------alltegkdytvllgppsgkpvvveFfaywCphCkkfeptlevl
00491021   1/1  ---------------------------------------spmpmkidfyfDpvcPwcylalprleellar
00446191   1/1  --------lkklllllalllallsailltelpledf.ivlgkkdakvvlvvFsdpwCPyCkrle....pv
00369371   1/1  -------------------llallsllavveltldnfivlgaksgkvvlvvFsdpwCpyCkklk.pvlee
00438451   1/1  --------------------llaplslevvleltldnfivlgakngkvvlvvFsdpwCpyCkrle.pele
00444551   1/2  -------knlldedllldiakeaGldaekfdaalnsfavkalvekaeklaeklgvrgtPtfvvngkylvg
00377041   1/1  -------------------------------------------sgklvvvvfyapwCphCkalk.pllee
00519231   1/1  ------------------llvgdpaPdftlpvldldgktfsladlkgkpvlvnFwatwCppCkae.lpel
00393011   1/1  ----------------------------eltdenfeelvlks..gkpvvvvFyapwCpyCkala.pllee
00444552   2/2  ----------------------------------------------------------------------
00457401   1/1  -----------------------------ltdeefeelvkn.ldgkpvvvvFyapwCpyCk.alapllee
00515951   1/1  ------------------------------------------liellelvsvvklltleeleellksgkp
00388001   1/1  ------------------------------kltdelfellkelsgkvvvvvfsapwCpyC....krakpl
00490481   1/1  ----------------------------avieltgenfdlallkgkpvlvdfwapwCgpCk.alapvlee
00524511   1/1  -----------------------sspvveltlenfdelvld..sgkpvlvdfyapwCgpCkalapvl.ee
00483631   1/1  --------------------------------------------lkPvlvdfyapwCppCk.alkpllee
00490891   1/1  -------------------lslpaapdftvveltgenfdlallsgkpvlvdfyapwCgpCk.alapvlee
00466031   1/1  --------------------------dlsvieltglenfdlallkakaegkpvlvdfyapwCgpCk.ala
00498571   1/1  -----------------------aegqpapdfvvlltldgfalaladlsgkpvlvdfwaswCgpCkala.
00417221   1/1  -----------------lllvgdpapvfeltdldgeevvlsdlkgkpvlvyFwaswCppCkalapvl.ee
00494961   1/1  -----------------------------svveltgeanfdlallegkpvlvdfyapwCgpCk.alapvl
00509501   1/1  ----------------lllevgkpapdfsvvdld.enfdlavlkgkpvlvdfyapwCgpCk.alapvlee
00457391   1/1  -----------------------------ltdlnfldevlsdlsgkpvlvdfyapdwCgpCk.alapvle
00511291   1/1  --------------------------------aglpapdvvlltldgfdelladlsgkpvlvdfyapwCg
00501081   1/1  --------------llllllllalapevlllsleefeellkdlkgkpvvvdfwasddetgksWCppCk.a
00519141   1/1  ------------------lsellalpdfsvveltgenfdlallegkpvlvdfyapwCgpCkalap.vlee
00462951   1/1  ---------------------------lsvveltgenflslvllsgkpvlvdfwapwCgpCk.alapvle
00393001   1/1  -----------------------llldgnvkeltdenfeellksgkpvlvvfyapwCpyCk.rlkpllee
00493771   1/1  ----------------------------------Llglaappvtlldlgealelallsgkpvlvdfyapw
00481461   1/1  -----------------------dlPafsgavveltgenfdlalasgkpvlvdfyapwCgpCk.alapvl
00469821   1/1  --------------------------------lpvvvlltlenfdelladlkgkpvlvdfwapwCgpCk.
00496331   1/1  ----------------------------------aegkpapdfsvveltgenfdlavlkgkpvlvdfwap
00374741   1/1  ------------------------------------------vleltddnflelvlksgkpvlvdfyapw
00496321   1/1  ------------------------------------------sgpvieltdenflelvllsgkpvlvdfw
00395271   1/2  mkrllllllllllllllaallaalaslelllvgdpapdftltdldgkevslsdlkgkpvlvdfy------
00395272   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRASEAAACAAEQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
00515031   1/1  llkeypddgkvrlvlrhfpllgehplaaaaaraalaagdqgkflefhdalfaaqpewg...gllteelll
00354991   1/1  laeelpd..kvkfvkvdvdllggpnsllaaraalaaaalgkflklhdalfeaqfeegldlsd..levllk
00377991   1/1  eklakklpddgkvkvvkvdvp..lgpnsllaaraaaaakalgkfwklhdalfeaqfeegtnl..dlev.l
00491021   1/1  ygveiewrpfllgpgnpdagvtvveffdykcpycarfe.....prlaellg.gpvglvfrfvpllfppns
00446191   1/1  lkk.laeegkvtvvfvdvpl.lgpdslaaaraalcaadpgkaweflealfaaqpleg.............
00369371   1/1  lak.....ggvtvvyrpfplnglgpdsllaarailcaadqgk............................
00438451   1/1  elakey.....vtvvvilfpllgee.slaaakaalilcakdkykalhdalfgg.................
00444551   1/2  asgieslerllfilklllllllllllafaasaaapvegkdyvvllgpasgkpvvveF-------------
00377041   1/1  laeelpg..dvvfvkvd.....................................................
00519231   1/1  eelaeeykd..gvvvvgvnvdllge.............................................
00393011   1/1  laaeykdlgkgkvkfvkvd...................................................
00444552   2/2  -----------------------------------------------------------knlldedllld
00457401   1/1  laeeyklllngkvkfvkvd...................................................
00515951   1/1  vvvvfgapwCpyCr.klapileelaeel....kvkfvkvdvdenelldei....................
00388001   1/1  leelavlypevelvkvdadef.................................................
00490481   1/1  laeelkd..gvvfvkvd.....................................................
00524511   1/1  lakeykdlglkgdvvfvkvdvd.d..............................................
00483631   1/1  laaeykd..gvvvvkvdvdenpe...............................................
00490891   1/1  laeel...pgvvfvkvd.....................................................
00466031   1/1  pvleelaeelkg..gvvfvkvdvden............................................
00498571   1/1  peleelaeeyklldgvvvvkvdvddrp...........................................
00417221   1/1  laekykdekgvvvvkvdvd..............dnpeelkeflkklglpfpllldpdvl...........
00494961   1/1  eelaeel...dgvvfvkvdv..................................................
00509501   1/1  laeel..kg.vvfvkvdvden.................................................
00457391   1/1  elaeeykgl.gvvfvkvdvd..................................................
00511291   1/1  pCk.alapvleelaeelkd..gvvfvkvdv........................................
00501081   1/1  laPvleelakeykd..dvvfvkvdvdenp.........................................
00519141   1/1  laeelkgkg.vvfvkvdvdenp................................................
00462951   1/1  elaeelkd..gvvfvkvdv...................................................
00393001   1/1  laeeypgl.kvvfvkvd.....................................................
00493771   1/1  CgpCkala.peleelaeeyk..gnvvfvkvdvdrenpd................................
00481461   1/1  eelaeeykglnkgvvfvkvd..................................................
00469821   1/1  alapvleelaeel...dgvvfvkvdvden.........................................
00496331   1/1  wCgpCk.alapvleelaeelkg...vvfvkvdvden..................................
00374741   1/1  CgpCkala.pvleelaeeykg..gvvfvkvdv......................................
00496321   1/1  apwCgpCk.alapvleelakelkd..gvvfvkvd....................................
00395271   1/2  ----------------------------------------------------------------------
00395272   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKA
00515031   1/1  klakelgldaekfeaalds.........dlelaealgvtgTPtfvingkllvgavsleeleelid-----
00354991   1/1  iaaeagldaaaflaalnsdavkalveeneelaekygvrgvPtlvinGkyvvryvGarsleellefidkl-
00377991   1/1  lkiakeagldaekflaalnsfavkalvdaneelaeklgvrgvPtfvingkyvvlyddllrlsgaqslee-
00491021   1/1  llaaraalaaaaqgpgkflelldalfraifvegrdisd..pevlaelaaeaGlslldaaeflaalnspe-
00446191   1/1  .............aclnsaavdaavdenlelaeklgvrgtPtifinggggilvvvgGaldleell-----
00369371   1/1  ......gldaaalgalldsaaakvdvdenqelaqklgvrgtPtlvifnGkvvvGaqplealeellekllg
00438451   1/1  ...............alkseavkvdvdenlelaeqlgvrgtPtivifnGklivGavpleqleealek---
00444551   1/2  ----------------------------------------------------------------------
00377041   1/1  ........................vdenpelaekygvrgvPtlvifkng.kyvgaldleellellek---
00519231   1/1  .......edspealkkflkelgldfpvlldedgelakaygvrgtPttflidkdGkivarlvGalda----
00393011   1/1  ..........................vdenpelaekygvrsvPtivlfkngkevgryvgarsleelle--
00444552   2/2  iakeaGldaekfdaalnsfavkalvekaeklaeklgvrgtPtfvvngkylvgasgieslerllf------
00457401   1/1  ..........................vdenpelaekygvrsvPtlvlfkngevvgrfvgarsleelle--
00515951   1/1  ...................................................qelaekygvrgvPt-----
00388001   1/1  ............................qelaeeygvrgvPtifingkeiggglpsldellalle-----
00490481   1/1  ........................vdenpelakkygvrgiPtlllfddgkivaryvGaldaeellefl--
00524511   1/1  .................................lakkygvrgiPtlllfdnGkevarlvytgartaeel-
00483631   1/1  ..............................laerygvrgvPtllidgkvvvvgardleeleeflkk...e
00490891   1/1  ........................vdenpelakkygvrgvPtlllfdnGkevaryvGa.daeellefle-
00466031   1/1  .................................pelakkygvrgvPtlllfddGkevaryvGa.daeell
00498571   1/1  ..............................dengelakkygvrgiPtlvlfdkdGkivaalryvGalda-
00417221   1/1  ............................gelakaygvrgiPtlvlidkdGkvvaryvgardaeeleefl-
00494961   1/1  ...........................denpelakkygvrgiPtlllfdnGkevaryvGa.daeelle--
00509501   1/1  ............................pelakrygvrgvPtlllfdnGkevaryvGa.daeellefl--
00457391   1/1  ...........................enpelaekygvrgvPtlllfddGkevdlryvGardaeellefl
00511291   1/1  .....................................denpelakrygvrgiPtlllfdnGkevary---
00501081   1/1  ...vlkdp..........................ngelakkygvtgiPtllvfkngkvvgrlvg.l----
00519141   1/1  .............................elakkygvrgvPtlllfddGkevallryvGaldaeellef-
00462951   1/1  ..........................denpelakkygvrgiPtlllfddgkivaryvGaldaeellef--
00393001   1/1  ........................vdenpelaekygvrgvPtlvlfknGkevggrfvGarsleelle---
00493771   1/1  ............................................laqkygvrggliPtlvlfdkdGkvva
00481461   1/1  ...........................vdenpelakkygvrgvPtlllfdnggklevaryvGaldaeell
00469821   1/1  ....................................pelakkygvrgiPtlllfkdGkevaryvGa.d--
00496331   1/1  ...........................................pelakkygvrgiPtlllfkdGkevar-
00374741   1/1  .......................................denpelakrygvrgiPtlllfkngkeva---
00496321   1/1  .........................................vdenpelakkygvrgiPtlllfkdGke--
00395271   1/2  ----------------------------------------------------------------------
00395272   2/2  ---------------------------dgilagelakaygvrgiPtlflidkdGkvvaryvgaldae---


                         -         -         -         +         -         -         -:280
query           E---------------------------------------------------------------------
00515031   1/1  ----------------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00377991   1/1  ----------------------------------------------------------------------
00491021   1/1  ----------------------------------------------------------------------
00446191   1/1  ----------------------------------------------------------------------
00369371   1/1  klr-------------------------------------------------------------------
00438451   1/1  ----------------------------------------------------------------------
00444551   1/2  ----------------------------------------------------------------------
00377041   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00444552   2/2  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00388001   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00524511   1/1  ----------------------------------------------------------------------
00483631   1/1  l---------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00498571   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00457391   1/1  e---------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00519141   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00393001   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00481461   1/1  ef--------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00395271   1/2  ----------------------------------------------------------------------
00395272   2/2  ----------------------------------------------------------------------