[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80854.1


[Show Plain Result]

## Summary of Sequence Search
   1::185
   1::185  2.9e-65 53.5% 0036999 00369991 1/1   ome recycling factor, RRF               
   3::186  7.4e-64 54.3% 0036362 00363621 1/1   ome recycling factor, RRF               
   2::186  8.6e-64 54.1% 0039174 00391741 1/1   ome recycling factor, RRF               
   2::186  9.6e-64 53.5% 0037049 00370491 1/1   ome recycling factor, RRF               
   1::186    3e-63 53.3% 0038065 00380651 1/1   ome recycling factor, RRF               
  31::113  2.1e-29 55.4% 0050587 00505871 1/1   ome recycling factor, RRF               
   1::185


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLKELYAETRSHMQKSLEVLEHNLAGLRTGRANPALLLHLKVEYYGAHVPLNQIATVTAPDPRTLVVQS
00369991   1/1  veieiilkeleekmekavealkkelakirtgraspslldnilveyygsktpLnqlAsvsvkeartllitp
00363621   1/1  --inillkdaeekmekavealkeelakirtgranpslldnilveyygsktpLnqlAsvsvkeartllitp
00391741   1/1  -mieillkdaeekmekavealkeelakirtgranpslldsilveyygsktpLnqlAsvsvkeartllitp
00370491   1/1  -mieillkdaeekmekavealkeelakirtgranpslldsilveyygsktpLnqlAsvsvkeartllitp
00380651   1/1  llvmieillkdaeekmekavealkeelakirtgranpslldnilveyygsktpLnqlAsvsvkeartlli
00505871   1/1  ------------------------------Graspslldgilveyygsktplnqlasisvpeartllikp


                         -         -         *         -         -         -         -:140
query           WDQNALKAIEKAIRDSDLGLNPSNKGDALYINIPPLTEERRKDLVRAVRQYAEEGRVAIRNIRREALDKL
00369991   1/1  fdkslvkaiekailksdlglnPqndgqvirvviPplteerRkelvklvkklaeeakvairniRrdaldkl
00363621   1/1  fdkslvkaiekailksdlglnPqndgevirvviPplteerRkelvklvkklaeeakvairniRrdaldkl
00391741   1/1  fdkslvkaiekailksdlglnPqndgevirvviPplteerRkelvklvkklaeeakvairniRrdaldkl
00370491   1/1  fdkslvkaiekailksdlglnPqndgevirvviPplteerRkelvklvkklaeeakvairniRrdaldkl
00380651   1/1  tpfdkslvkaiekail.sdlglnPqndgevirvviPplteerRkelvklvkklaeeakvairniRrdald
00505871   1/1  fdlksllkaiekailesdlglnPvndgevirlplPelteerrk---------------------------


                         +         -         -         -         -         *         -:210
query           KKLAKELHLSEDETKRAEAEIQKITDEFIAKADQLAEKKEQEILG-------------------------
00369991   1/1  kklekdkeiseDelkklekelqkltdkyikkidelleekekelle-------------------------
00363621   1/1  kklekdkeiseDelkklekelqkltdkyikkidelleekekellev------------------------
00391741   1/1  kklekdkeiseDelkklekeiqkltdkyikkidellkekekellev------------------------
00370491   1/1  kklekdkeiseDelkklekelqkltdkyikkidellkekekellev------------------------
00380651   1/1  klkkdke...iseDelkklekelqkltdkyikkidellkekekell------------------------
00505871   1/1  ----------------------------------------------------------------------