[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80912.1


[Show Plain Result]

## Summary of Sequence Search
   1::427
   4::427 5.9e-130 44.4% 0052943 00529431 1/1   ependent transferases                   
   6::427 2.5e-125 45.9% 0042809 00428091 1/1   ependent transferases                   
  14::427 1.6e-119 43.3% 0051601 00516011 1/1   ependent transferases                   
  38::427 3.1e-119 44.2% 0052157 00521571 1/1   ependent transferases                   
  16::427 5.3e-117 43.9% 0043583 00435831 1/1   ependent transferases                   
   5::427 4.8e-112 44.3% 0045392 00453921 1/1   ependent transferases                   
  17::427 1.3e-109 40.7% 0051517 00515171 1/1   ependent transferases                   
  28::427  9.4e-90 41.9% 0048571 00485711 1/1   ependent transferases                   
  29::427  2.4e-77 36.9% 0046747 00467471 1/1   ependent transferases                   
  17::428    2e-73 34.9% 0050157 00501571 1/1   ependent transferases                   
  34::427  4.7e-67 30.5% 0044083 00440831 1/1   ependent transferases                   
   7::427  6.3e-65 34.2% 0052070 00520701 1/1   ependent transferases                   
  38::427  5.8e-59 36.9% 0046007 00460071 1/1   ependent transferases                   
  32::428    8e-57 30.7% 0035246 00352461 1/1   ependent transferases                   
  31::429  6.8e-52 32.2% 0050261 00502611 1/1   ependent transferases                   
   5::427  2.3e-49 27.1% 0050753 00507531 1/1   ependent transferases                   
  31::427  6.5e-48 29.7% 0053335 00533351 1/1   ependent transferases                   
  38::426  2.5e-43 32.6% 0049754 00497541 1/1   ependent transferases                   
   4::427  5.3e-43 31.1% 0050754 00507541 1/1   ependent transferases                   
  38::428  1.7e-42 31.3% 0044807 00448071 1/1   ependent transferases                   
  36::427  1.9e-41 30.2% 0036406 00364061 1/1   ependent transferases                   
  20::427    2e-38 28.3% 0035589 00355891 1/1   ependent transferases                   
  24::427  5.3e-35 26.7% 0041674 00416741 1/1   ependent transferases                   
  32::427  6.6e-35 25.7% 0051757 00517571 1/1   ependent transferases                   
  55::425  1.2e-34 26.3% 0049486 00494861 1/1   ependent transferases                   
  74::428  1.8e-32 26.9% 0041704 00417041 1/1   ependent transferases                   
  53::427  3.1e-32 30.6% 0042144 00421441 1/1   ependent transferases                   
  49::426  1.8e-31 29.2% 0046584 00465841 1/1   ependent transferases                   
  54::427  1.4e-30 25.3% 0045973 00459731 1/1   ependent transferases                   
  36::427  4.9e-30 25.3% 0050390 00503901 1/1   ependent transferases                   
  60::427  5.7e-29 27.8% 0048952 00489521 1/1   ependent transferases                   
  60::427  1.1e-28 28.1% 0048074 00480741 1/1   ependent transferases                   
  39::427  2.7e-28 29.2% 0040134 00401341 1/1   ependent transferases                   
  54::427  2.8e-28 27.1% 0050076 00500761 1/1   ependent transferases                   
  38::427    1e-27 25.9% 0046087 00460871 1/1   ependent transferases                   
  30::418  1.5e-26 23.8% 0042806 00428061 1/1   ependent transferases                   
  71::427  1.2e-24 23.2% 0046165 00461651 1/1   ependent transferases                   
  30::421  2.1e-23 24.6% 0045171 00451711 1/1   ependent transferases                   
  54::427  5.4e-20 29.3% 0046547 00465471 1/1   ependent transferases                   
  27::427  3.8e-19 25.8% 0046024 00460241 1/1   ependent transferases                   
 114::427  7.2e-19 27.6% 0049070 00490701 1/1   ependent transferases                   
  30::428  1.7e-18 25.7% 0051195 00511951 1/1   ependent transferases                   
  28::421  1.6e-17 23.1% 0045639 00456391 1/1   ependent transferases                   
  25::427  3.3e-17 26.1% 0039341 00393411 1/1   ependent transferases                   
  99::427  1.7e-16 26.4% 0048747 00487471 1/1   ependent transferases                   
  24::427    6e-16 25.9% 0050696 00506961 1/1   ependent transferases                   
  59::427    7e-16 24.6% 0047441 00474411 1/1   ependent transferases                   
  48::427  1.2e-15 24.6% 0047095 00470951 1/1   ependent transferases                   
  72::427  1.3e-15 26.1% 0044595 00445951 1/1   ependent transferases                   
  20::428  2.2e-15 25.1% 0035401 00354011 1/1   ependent transferases                   
  67::427  4.1e-15 27.0% 0038952 00389521 1/1   ependent transferases                   
  54::427  7.3e-15 25.2% 0037569 00375691 1/1   ependent transferases                   
  70::429  2.6e-14 24.5% 0046154 00461541 1/1   ependent transferases                   
  54::427  7.5e-14 22.0% 0047670 00476701 1/1   ependent transferases                   
  40::428  1.4e-13 24.4% 0036780 00367801 1/1   ependent transferases                   
  58::427  2.4e-13 25.0% 0052164 00521641 1/1   ependent transferases                   
  50::425  5.6e-13 23.0% 0038034 00380341 1/1   ependent transferases                   
  60::428  7.8e-13 24.1% 0047340 00473401 1/1   ependent transferases                   
  27::427  8.6e-13 25.4% 0051323 00513231 1/1   ependent transferases                   
  34::427  4.1e-12 24.9% 0047956 00479561 1/1   ependent transferases                   
  29::427  7.5e-12 25.6% 0046965 00469651 1/1   ependent transferases                   
 116::427    1e-11 22.1% 0042383 00423831 1/1   ependent transferases                   
  38::427  1.4e-11 23.6% 0035846 00358461 1/1   ependent transferases                   
  70::427  2.4e-11 24.7% 0049524 00495241 1/1   ependent transferases                   
  27::424  3.1e-11 23.3% 0045068 00450681 1/1   ependent transferases                   
 188::427  1.1e-09 27.1% 0050768 00507681 1/1   ependent transferases                   
 114::427  1.7e-09 26.2% 0046056 00460561 1/1   ependent transferases                   
  38::427  1.8e-09 21.5% 0041260 00412601 1/1   ependent transferases                   
  26::424  5.8e-09 20.1% 0035073 00350731 1/1   ependent transferases                   
  60::428  9.7e-09 24.2% 0040897 00408971 1/1   ependent transferases                   
 188::424  1.4e-08 21.6% 0045231 00452311 1/1   ependent transferases                   
 188::427  6.4e-08 28.2% 0050977 00509771 1/1   ependent transferases                   
  56::427  2.2e-07 25.3% 0035700 00357001 1/1   ependent transferases                   
 216::427  4.3e-07 26.9% 0052862 00528621 1/1   ependent transferases                   
  74::428  7.8e-07 22.7% 0052302 00523021 1/1   ependent transferases                   
  61::428  1.3e-06 24.1% 0047581 00475811 1/1   ependent transferases                   
 188::427  8.9e-06 25.9% 0046089 00460891 1/1   ependent transferases                   
 219::423  0.00019 26.3% 0044523 00445231 1/1   ependent transferases                   
  93::346  0.00048 23.2% 0046206 00462061 1/1   ependent transferases                   
   1::427


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEGMERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
00529431   1/1  ---lklpkskelleellellpggvwhpvrafrlygplplvivraegaylydvdGneylDflsglgvlnlG
00428091   1/1  -----mpkslelldraklllpggvnsyvr.......lplvieraegaylydvdgnrylDflsgigvlnlG
00516011   1/1  -------------msskelipgdlnsllrpftglld.plvivraegaylydvdGneylDflsglgvlnlG
00521571   1/1  -------------------------------------PlvivraegayltdvdGneylDflsglgvlnlG
00435831   1/1  ---------------geldlpglvhpftralslygplplvivraeGaylydvdGnrylDflsgigvlnlG
00453921   1/1  ----ptprskellerakklllggytsl..........plvivraegaylydvdgnrylDflsgigvlnlG
00515171   1/1  ----------------llglpglvlllvralllygllplvivraeGaylydvdGneylDflsgigvlnlG
00485711   1/1  ---------------------------lelslpllltelpglsselllelllslllslyaplplvivrae
00467471   1/1  ----------------------------lllllllllllldeelllllaeelyrlplvivrgegarlldv
00501571   1/1  ----------------leellelleslll..sllyrlplvivraegayltdvdgrryldlssglpvnplG
00440831   1/1  ---------------------------------lgslpepevgaqgepieliageeyldalvgaglinlg
00520701   1/1  ------llldsleelldelipeglrrp...fplllglplvlvralg.rlldvdgkeyldl.asnnylg.l
00460071   1/1  -------------------------------------dlldlldelleelkpeglyrplpivkgegarli
00352461   1/1  -------------------------------rkfiaeplriksaegvyltdvdgreyldalsgynvlllg
00502611   1/1  ------------------------------lsslplsllldlnlslssrlplvpldlirelladadgpdv
00507531   1/1  ----lryigptegeiaemldalgvesldelfadvpaslrrkgllllpglselevlrhltdlagknygddl
00533351   1/1  ------------------------------lfkrlgrlppspirgllalladldgkdvidlgvgiyldpe
00497541   1/1  -------------------------------------nmllserldrlppsailelleladgpdvidlgs
00507541   1/1  ---ryippteeeiaemldai..gvssldelfdp...ipleirrgeglplpdlserevldelsglasknlg
00448071   1/1  -------------------------------------plvllrairsllpdgdgviylds...agp...g
00364061   1/1  -----------------------------------lnpalsetellrelldlasnnylgl...asvillg
00355891   1/1  -------------------Ms.llssrllglk....pslvleilelaalldadgkdvidlgagepd...l
00416741   1/1  -----------------------issrllnlp....pyvfdeilelaalldadgpdvidlgvgepd...l
00517571   1/1  -------------------------------elirketlrlrggin..........asenvlslnvlgaq
00494861   1/1  ------------------------------------------------------liyldsdattpp....
00417041   1/1  ----------------------------------------------------------------------
00421441   1/1  ----------------------------------------------------kgviyldsaat......t
00465841   1/1  ------------------------------------------------efpllkgliyLdnaa......l
00459731   1/1  -----------------------------------------------------dkllsellelllaagll
00503901   1/1  -----------------------------------mllserldrlgpsvidellelaggpdvidlgigep
00489521   1/1  -----------------------------------------------------------mdlsklldrle
00480741   1/1  -----------------------------------------------------------iyldnagptpl
00401341   1/1  --------------------------------------miplgsetrklldlisndylg..laeiyllya
00500761   1/1  -----------------------------------------------------gtehidflsd....npt
00460871   1/1  -------------------------------------lklllepfrikvvepidptiaeeiekelkragg
00428061   1/1  -----------------------------lfsrlkalppspilklleaakrlggpdvidLgvgvyldlep
00461651   1/1  ----------------------------------------------------------------------
00451711   1/1  -----------------------------lfsrlkalppdpilallalaaedpgpdvidlgvgvyldlep
00465471   1/1  -----------------------------------------------------dliyld...naap...t
00460241   1/1  --------------------------mmdlssrlerlppsvirkllelaardaggpdvidlgigepd...
00490701   1/1  ----------------------------------------------------------------------
00511951   1/1  -----------------------------llkrllkldtlairagfpllartggvivldlsagtppfp..
00456391   1/1  ---------------------------mslfsrlkalppspilellelakelpgpdvinlgigvyrdeep
00393411   1/1  ------------------------mllssrlrnlkpyvigpilelaaelgad.gpdvidlgvgepd...l
00487471   1/1  ----------------------------------------------------------------------
00506961   1/1  -----------------------pgsgtfvsdrlpdlppspirellela...ggpdvidl..gigepdlg
00474411   1/1  ----------------------------------------------------------iyldgpgpt...
00470951   1/1  -----------------------------------------------llllllfpllllfpllkgliyLd
00445951   1/1  ----------------------------------------------------------------------
00354011   1/1  -------------------Mssflklllssrlkslkpsvilellelaaelgangpdvidlgvgepdfgpp
00389521   1/1  ------------------------------------------------------------------lllt
00375691   1/1  -----------------------------------------------------gpdvinlgigdp...df
00461541   1/1  ---------------------------------------------------------------------l
00476701   1/1  -----------------------------------------------------hprflgylpsgpl.ppa
00367801   1/1  ---------------------------------------kdlsletlaihagsgpdvlnl..vgppiylt
00521641   1/1  ---------------------------------------------------------lrllfpirelfpl
00380341   1/1  -------------------------------------------------llalgtdvihlgsgepdylgp
00473401   1/1  -----------------------------------------------------------ealgkdliylg
00513231   1/1  --------------------------klllskrldrlgpspi...rallllaagpdvidlgigepd...f
00479561   1/1  ---------------------------------llppspilsllelaaelgaggkdvidlsvgepd...f
00469651   1/1  ----------------------------llskrlerlppspilelle..llaggpdvidlgvgepd...l
00423831   1/1  ----------------------------------------------------------------------
00358461   1/1  -------------------------------------pplfdalvklaeegpysfhvpghkggv.lnfas
00495241   1/1  ---------------------------------------------------------------------l
00450681   1/1  --------------------------mlsllsnlkplppdpilglleaakadpgpdvinL..gigvyrde
00507681   1/1  ----------------------------------------------------------------------
00460561   1/1  ----------------------------------------------------------------------
00412601   1/1  -------------------------------------ealellalgtdvihlgsnenp...lgavappiy
00350731   1/1  -------------------------lmlslfsrlealppdpilglleaakkdpgpdkinlgiGvyrdeep
00408971   1/1  -----------------------------------------------------------iplplgepdf.
00452311   1/1  ----------------------------------------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00357001   1/1  -------------------------------------------------------kplvylfsaGPapl.
00528621   1/1  ----------------------------------------------------------------------
00523021   1/1  ----------------------------------------------------------------------
00475811   1/1  ------------------------------------------------------------midlrsdtvt
00460891   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------
00462061   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTNRPYI
00529431   1/1  hahpevvealkeqldrlghvsgttepavelaelLaellpglekvfftnsGseAneaalklaraytgrdki
00428091   1/1  hnhpevvealaeqldrllhgsflggltelavelaerlaellplgldrvfftnsGseAneaalklarayal
00516011   1/1  hshpevveaikeqldklghvsfgfttepavelaekLaellpaglekvfftnsGseAneaalklaraytgr
00521571   1/1  hahpevvealkeqldklghvsgttelavelaekLaellpglekvfftnsGseAneaalklaraytgrdki
00435831   1/1  hnhpevveavaeqldkllhvsflglttepavelaellaellpgglldkvfftnsGseAveaalklarayt
00453921   1/1  hnhpevvealkeqleklgytssggttelaealaellaellp.ldrvfftnsGseAnelalklarayylak
00515171   1/1  hnhpevveaiaeqldkllhvsllhepavelaelllelaplgldkvffvnsGseAveaAlklarayalalg
00485711   1/1  gaylydvdGnrylDflagigvvnlGhnhpevveaiadeeqldkllhvallsngaphepaeelaeklaela
00467471   1/1  dgreyidl.asnnylglgh.hpavleaaiealdkygvgspgsrllyg.ttplhdeleerlaellga.eaa
00501571   1/1  hsppevlealaealdrlgngssygptpgveelrealaellgadpaevlftnggteAlelalkaarllgpg
00440831   1/1  hghpdvvidLlsdtltgpvltaqlaellpgdryyggnpgvdeLeerlaellg.aehavftnsGteAnlla
00520701   1/1  htppavleavlealekygvgsggsrlsygttelleeleealaellga.eevlltssGteAneaallalra
00460071   1/1  dvdgreyldlssn..dylgghthpevveaaaealdklglgsggsrllygtnplheeleealaellga.ea
00352461   1/1  hgdpeiDlltDsgtsaasdaqlaallvgddayggdplafeleealaelfg.ldavlftnsGteAnelalk
00502611   1/1  idlgsgepdlglgp.ppavlealaealaelgpgllgygppeglp.elrealaellaelfgaea.adpeei
00507531   1/1  iylglgalghkppavieallealegltaytpyqpelsqgalelleelqerlaellga.daanvvltdggt
00533351   1/1  pdlppppavlealaealddgagllgypdpaGlpelrealaellarlfgvevdpeeiaalltnggtealel
00497541   1/1  gepdlpp...ppavlealaealdngllgyppsqglpelrealaellaellg.adldpetevlltsggtea
00507541   1/1  vdplfyldgaattpvppavlealaealtagnpysphelsqgaleleeelaerlaellga.daaivftsgg
00448071   1/1  plppavlealaeall.ghlsygategleelrealaellg.adpayevvftsggtealeaallallk..pg
00364061   1/1  asttpvppavleallealenkygegypgsrlyqgtlsvdpleeeleerlaelfgaeaailltnsGtaAnl
00355891   1/1  ppppavlealaealdsgllgygpppglpelrealaellgarygvavdpeeivvtnggtealelalrallg
00416741   1/1  ppppavlealaealesg.llrygdptglpelreaiaellgrrrgvavdpeevvvtnggtealelalral.
00517571   1/1  t.spevieaaeealggygysrggdplreeleellaelfga.eaalvtssgtaAillallallk..pgdei
00494861   1/1  ..ppavlealaealevgdgnygsdpgleelrealaellga.eaaeivftsgGteAnllallalld..pgd
00417041   1/1  ---Pevlealaevlesg.wlygtgpgveeleealaellg.aeeavftssgteAlnlallalg.lgpgdev
00421441   1/1  pvppevlealaealeslllfgnphslghelsrgatplleelrellaellga.dpaeivftsggtealela
00465841   1/1  gllppavleamaealeelagngssghrlsrgatelveelreklaellgadpeeviftssgtealnlalka
00459731   1/1  rldpeifsalrkelkrgkdlinliasnnyl.....ppavleallealtnkygegypgsrlylgteavgpl
00503901   1/1  d...lppppevlealaealdsgalllrypdpaglpelreaiaellgrrygvdvdpeeeilvtnGgteale
00489521   1/1  tlalhagllpdvllatgadviplgqgepdvppaveealallgagatgygysrgtg.plrealeerlaell
00480741   1/1  ...ppavlealleglghrsgygytelle.elrellaellgadedaeevlltsggtealeaallall..kp
00401341   1/1  setpvppevlealleallnkygegnpgsryyggtlyvdplveeleerlaelfgaeaalvftnsGtaAnla
00500761   1/1  gphpavlealaeallgddlgygadplveeleeklaellgaeaavlftsgGteAnllallaare..pgdev
00460871   1/1  nlfllasenvyidlvsdalt...gsplpamyaal....evgddyygggptvdeleervaelfg.aehavf
00428061   1/1  dlpp...ppavlealaealeegllhgYpppaGlpelreaiaelllrrygvgldpervaivvtnGgteala
00461651   1/1  kldtllvhagrlldlgtggidliilstgeppfpvpeavlealaealasghlygygpgpgveelrealael
00451711   1/1  dlppppavlealaealedgltlgYgppeglpelreaiaellarygvgvdpeevvvtnGgtealalalrll
00465471   1/1  plppevleamaealeklygnpssghelgygatelleelrealaellga.dpdeiiftsggtealnlalla
00460241   1/1  fppppavlealaealdelldgagllgYpdpqGlpelreaiaellgrrygvdvdpallkledeivvtnGgt
00490701   1/1  -------------------------------------------ivftssgtaalnaallalgaallsplk
00511951   1/1  .vpeavlealaealaggrygyggnpgveeleealaellg.aeealvtsggtaaillallal..lkpGDev
00456391   1/1  dl...ptppavkealkealeegltlgYlpiaGlpelreaiaelllrrygldldpdrivlvqtlsttGate
00393411   1/1  ppppavlealaealesgllgygpspglpelrealaellgarygvavdpeeivvtnggtealllallallg
00487471   1/1  ----------------------------deleealaellga.eealvtssgteAlelallal..lkpGDe
00506961   1/1  ppplpaviealaealdsggalllgygdpaglpelreaiaeylgrrrgvdvdpeqilvtnGatealelalr
00474411   1/1  plppevlealarall.shrsyeftagleelrealaellgadpdvvlltgggtealeaallal..lgpgdk
00470951   1/1  nagptplppevleamleal.ihhlgpeftelveearellaellgadpgeevvftgggtealeaallgl..
00445951   1/1  -lelssrldglpaslirellelaggpdvidlgvgepdlpppeavlealaeal.ggllgypdppglpelre
00354011   1/1  lldllgltlplpavlealaealaegllgYpdpaGlpelreaiaellarrygllvgvdpeeilvtnGatea
00389521   1/1  lvlpavlealaeald.gllgYpdsaglpelreaiaeylarrygglvgvdpeeilvtnGatealelllral
00375691   1/1  plppavlealalaelidldanenplgpslaaldagllrypdp.glpelreaiaell.gvdpeeilvtnGa
00461541   1/1  selllllleglyevdpeiaeliekelkrqgevllliasenylspavlealgsaltnkyaegypgsryygg
00476701   1/1  vladllaaalnqnlltyelspgateleeevadwlaellglpvaflllgadpaggvftsGgteAnllalla
00367801   1/1  nefvfelpeavlealaegltgytysrggnplrealeeklaeleg.aeealvtssgtaAieaallal..lk
00521641   1/1  lmdliyldnagpt...plppevleamlealishrspeftelveearellaellgadpyeeivftgggtea
00380341   1/1  vappiylsstftfevleaviealagggtgydysrgpnptvealeealaellg.aeaalvtssgtaAilla
00473401   1/1  sgapglgtppvvraaaeaaadlfanplsggeysrganptleeleealaellg.aeealltsggtaailaa
00513231   1/1  ppppavlealaealdeggalllgYpdpaGlpelreaiaeylarrygvgvdpeeeilvtnGatealalllr
00479561   1/1  ppppavlealaeald.g.llrypdpglpelreaiaallg.vdpeeilvtnGatealalllral....pgd
00469651   1/1  ppppavlealaealdsg.llgygppaglpelreaiaeyllrrrgvgvdpeteilvtnGatealalalral
00423831   1/1  ---------------------------------------------ftsGgteanllallaarnralpkrk
00358461   1/1  nlylgfpdfpgpnealealgaalggldllygpsggileleealaelfgaddaifvtnGtseanlavilal
00495241   1/1  ldlldirllfpalslfalgkdliyldnaattplppevleamleallellgnphssgyslsrganplveel
00450681   1/1  epdlppppavkealaealedgllllrYppiaGlpelreaiaelllgeygv.gldpervaivvtnGateal
00507681   1/1  ----------------------------------------------------------------------
00460561   1/1  -------------------------------------------vvftsggtealnlallalaaahlkpgd
00412601   1/1  qtptfvldalaealdggrygrgpnpgleeleealaellg.aeevlltsggtaaif.allal..lgpGdev
00350731   1/1  dlpvppavkealaealedlegllgYlpiaGlpelreaiakllfgryglaldperiatvvtnGgtealsla
00408971   1/1  ..peevleaviealdsgg..ytrgpgvaeleealaellg.aehavatnsgtaAlllallal.glgpGDeV
00452311   1/1  ----------------------------------------------------------------------
00509771   1/1  ----------------------------------------------------------------------
00357001   1/1  ..ppevleamlkelldllgnglsvleishrskefteileearellaellgapddyevvlltgggtaalea
00528621   1/1  ----------------------------------------------------------------------
00523021   1/1  ---mkfetlllhagldpdpltgavnppiylsstpvfdtpeeiaaafealesgyiysriggptveeleeal
00475811   1/1  pptpevleamaea.nvgddvygedptvneleerlaellg.keaavfvpsGtmanllalaal...lqpgde
00460891   1/1  ----------------------------------------------------------------------
00445231   1/1  ----------------------------------------------------------------------
00462061   1/1  ----------------------rqvggivlilsenappfyvpeavldalteayaegfagyrggygysrlr


                         +         -         -         -         -         *         -:210
query           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLRRRGEEIAAIIFEP
00529431   1/1  isfeggYHGrtlgalsltgsgayrlgfaplpgvprlpapdtyrvpyndlealeallaehgdeiaavivep
00428091   1/1  akgtprdkilvfegaYHGrtlgalsltgsklyhaslfgpllpgvvgvpapylyrteelgyndldaleall
00516011   1/1  dkiisfeggYHGrtlgalsltgssyiegfgpllagvvhvphpdtyrlpyndeleelgllllealeellee
00521571   1/1  isfeggYhGrtlgalsltgspadrlgfapllggvrlpapdtyrvpyndlealealleelgddiaavivep
00435831   1/1  grtkiisfegayhGrtlgalsltgsgllrapfgpllpgvvhvpapllyrlllleyndlealealieellg
00453921   1/1  grlgtggdkilvfeggYHGrtlgalsltgs.......psylggfgplgagvvvvpypdlealeaaie..p
00515171   1/1  klgtgrtkiisfeggYHGrtlgalsltgsglyrlgfgpllpgvvhvpfp.........dllllllalggd
00485711   1/1  pegldkvfftnsgseaveaalklarqyglglggsrlvlgtlelheeleelladtgrekilvfsggyhgnt
00467471   1/1  lvfnsGteAnlaalral...lgpgdivlvdelnHgstldglrlsg...................aevvfv
00501571   1/1  devlvpepayHgstlaalrlagakvvevtfvpldp..........dglllpypdlealeaai...tpkta
00440831   1/1  lkallk..pgdevivpdlayggtteag.llaga...................kpvfvdvdedgnldleal
00520701   1/1  lgpgdevlvdelahhsildgarll...gaevvvvphn.................dldaleaalteagppr
00460071   1/1  allfnsGteAnlaalkall...gpgdivivdeltHgstldglrlsgak...................vvf
00352461   1/1  allayhrakgepgdtviis..ngyhgttlehvslag..akvvrvpfdpaldealll.....pedgnldle
00502611   1/1  vltnggteAlelalral..lgpGdevlvpdptyhgylaaarll...Ga.................evvfv
00507531   1/1  aaleaallalr.ltpgdevlvpdgahpsnlaalqtlaallGaevvvvpld.................dle
00533351   1/1  alralrklgpgdevivpsptypgylaaarla...Gakvvfvpldedgtfgi.............dleale
00497541   1/1  lelalrallg..pgdevlvpdptypgylaaarll...Gaevvfvplded..............gflldle
00507541   1/1  teAnllallaarryhrargelgpgdevlvpdpaHgsnlaaarll........Gae............vve
00448071   1/1  devlvsapghpsvl......laeaaerlGa............evvvvpvdedglldlealeaalee..hr
00364061   1/1  aallallk..pgdevlvddlahgstlagarlanasglGaevvfvpvded.............glidledl
00355891   1/1  ..pGdevivpsptypgylaaarll...Gaevvfvpldpdgtfgl.............dlealeaait...
00416741   1/1  .lgpGdevlvpsptypgylaaar...laGaevvfvpldedngfgl.............dlealeaait..
00517571   1/1  lvsrglyhgslihglklsgakvvfvd.....................dledlekaike...ktklvvl..
00494861   1/1  evlvsepahpsvleag.aaellGakvvpvpdedgkl.............dledleaaitedtahgllpkl
00417041   1/1  ivpspthvatlaailll...Ga.................kpvfvdvdetgnidlealeaaieehtpktka
00421441   1/1  llalrayglkpgdevlvsslehgsvlraaellerlGae.................vvlvpvdpdgrldle
00465841   1/1  l.rlgpgdeilvsalehpsvleaarllaerlgaevvfvpldeevdgll.............dlealeaal
00459731   1/1  veeleerlaelfgaeadelgvavftssGtaAlllallallkp..gdevlvpslahggstlaaarllGagv
00503901   1/1  lalralld..pGdevlvpdptYpgylaaar...laGakpvfvpldedgllplllglendflldlealeaa
00489521   1/1  ga.eevlltsggteAlelallall..kpGdevlvpdptypstlaaarll.akv.................
00480741   1/1  gdevlvsdpahgstl......yakaakllGa............evvfvpldedglidlealeaaiteg.p
00401341   1/1  allallk................pgdevlvpslahgstlaaarlagakrlgievvfvd.vdpetglidld
00500761   1/1  ivsataHisvleagailglggakvvlvpv.................dedgkldleaLeaairedtahvhg
00460871   1/1  thsGtaAnllallallkpGdevivpdhflahggfletggaallsgatpvfvdydlvdpdt........gn
00428061   1/1  lalrllallnpgdevlvpdptypnylaiarl.aGaevvevpldeendfgl.............dldalea
00461651   1/1  lgaeevlltsggtealelallallk..pGdevlvpdptypsylaaarl.......l.aevvfvpldedgg
00451711   1/1  allnpgdevlvpdptypgylaaa...rlagaevvpvpldeengfgl.............dlealeaalae
00465471   1/1  lrrallkpgdeilvsspehpsvlkaaellerlgae.................vvevpvdedgrldleale
00460241   1/1  ealllalralld..pGdevlvpdptYpgylaaae...laGaevvpvpldeeggfll.............d
00490701   1/1  pgdevlvsalehgsvlaalallaerlGaevvfvdv.................idlealeaal...tpdtk
00511951   1/1  lvpapaygsylallrlllkrfGaevvfvdld.................dlealeaai...tpktklvvle
00456391   1/1  alalllrallnpgdevlipdptypnylaaaklag..................akvvpvpldeengfgldl
00393411   1/1  ................pGdevlvpdptypaylaalrlaGaevvfvpl...dpdggflldpealeaait..
00487471   1/1  vivpsptygatleai....................rllakpvfvdvdedggndlealeaait...pktka
00506961   1/1  al..lgpGdevlvpsptYpaylaaarl...agakvvpvpl.....de........fgldlealeaaltea
00474411   1/1  vlvpapgyfsvr.laelaerlgaevvvvpvdpgglvdpeale..................tpdtklvllt
00470951   1/1  lkpgdkvlvssnghfsvl.laeiaerlGaevvvvpvdegg............lvdlealeealke..pkt
00445951   1/1  aiaallg.vdpeeivvtsGatealnlalral..lgpGdevlvpsptypaylaalrll...Gakvvfvpld
00354011   1/1  lelalral..ldpGdevlvpdptYpgylaaarlatgaevvpvpldeegg............flldleale
00389521   1/1  ldpG..devlvpdptYpgylaaarla..tgaevvpvpldeeggfll.............dlealeealte
00375691   1/1  tealalllral..lnpgdelvlvpdptYpgylaaar...lagaevvpvplded............fgldl
00461541   1/1  teyvdpleeeleerlaelfgaehallfanvqpssGtaAnlaallal..lkpgdevltpslehgGhlthgs
00476701   1/1  ardralprrkaeglaalgleglpglvilvsdpaHysvekaarl........lGlg............vrl
00367801   1/1  pGdevlvpeplygstlellralakllGaevvfvdld.................dledleaai...tpktk
00521641   1/1  leaallnl..lkpgdkvlvssnghfsvlaaeaa.erlGaevvvvpvdpgglvd..............lea
00380341   1/1  llal..lgpGDevlvpdplygstielfglalrlaGaevvfvdld.................dlealeaai
00473401   1/1  l.al..lkpGdevivsdpaygstlallrllleraGaevvfvdld.................dlealeaai
00513231   1/1  al..ldpGdevlvpsptYpgylaalr...lagakvvpvpldelltgglls.....eggflldlealeaai
00479561   1/1  evlvptptYpgylaaar...lagaevvpvpldndfgl.............dldaleaaik..tpktklll
00469651   1/1  ..lgpGdevlvpsptypayaaaar...laGakvvfvpldee..............ggflldlealeaait
00423831   1/1  aaglgipgpeilvs..paHysvlkaarllgievrlvpvdendgrm.............dlealeaaiden
00358461   1/1  lg..pGDevlvdrpsHksilnggar...laGakpvylp..tdrngfggiggirfkhldpealeealtelk
00495241   1/1  rerlakllgaddpeeivftsggtealnlallala............laglkpGdevivsapehpstlaaw
00450681   1/1  llaarflallnpgdevlvpdptypnylaiak..............laga..evvpvplddengfgldlea
00507681   1/1  -----------------------------------------------dlealeaalkeakeatpktkliy
00460561   1/1  evlvsalehpsnlaalrllaerlGaevvvvpvdpd............glldlealeaal...dprtklva
00412601   1/1  lvpaplygsylalarlalkrlGaevvfvd..................ldledleaai...tektklvfle
00350731   1/1  aeflkrflrallnpgdevlvpdptypnylaiarlagae..................nvvevplddentfg
00408971   1/1  ivpaltfvstanavlla...Gakpvfvdvdpdt............fnidpealeaai...tprtkaiv..
00452311   1/1  -----------------------------------------------dldallaalekatpktkllllnn
00509771   1/1  -----------------------------------------------dlealeaaltp...ktklvlltn
00357001   1/1  allnl.............lgpgdkvlvlvtghfgn.raadlakrlgaevvvvpvd.egglldleeleaal
00528621   1/1  ----------------------------------------------------------------------
00523021   1/1  aellga.....eealltssgtaAlllallal..lkpGDevivpaptygstaeairlllkrlGakpvfvdl
00475811   1/1  vlcdelaHilldeagaleflsgaklvplpgedgkl.............dpedleaairdddvhfprtrlv
00460891   1/1  -----------------------------------------------dlealeaaite..pktkllll.c
00445231   1/1  ----------------------------------------------------------------------
00462061   1/1  nptaealeralaaleg.aeevvltssgtaAialallal..lkpGDevlvsdplyggtltllrllgarggi


                         -         -         -         +         -         -         -:280
query           VVGNAGVLVPTEDFLKALHEAREFGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKVLGGGLPAAAY
00529431   1/1  vqgegGvivpppgflealrelcdehgallivDEvqtGfgrtglfafehfgvtpdivtlgKalggGlplga
00428091   1/1  aehgekiaavivepvvqgegGvivpppeflkalrelcdkhgilliaDEvqtgfgrtgklfafehagvtpd
00516011   1/1  lgpddiaavivEpvqgegGvivpppgylkelrelcdkygillivDEvqtGfgrtgklfafehfgvvpDiv
00521571   1/1  vqgegGvippppgylkalrelcdkygallivDEvqtgfrtgklfafehfgvvpdivtlgKalggGlplga
00435831   1/1  pdtiaavivePvqgnggvivpppgflkalrelcdehgilliaDEvqtgfgrtgklfafehagvvPDivtl
00453921   1/1  dtvaavivepvqgegGvivpppeflkalrelcrkhgillivDEvqtgfgrtgklfafehlgvtpdivtls
00515171   1/1  diaAvivEPvqgegGvivpppgflkglrelcdkhgillifDEVqtGfgRtgklfafehygvvPDivtlaK
00485711   1/1  lallaltgpgdevlvpdplypgylhaallagarvvfvpldvdedghldlealeaaleeldaggdrtaavi
00467471   1/1  phnDldaleallkelreegpkpkliivegvfsmtGdiaplkelreladky...gallivDeahaggvlga
00501571   1/1  avileppqnptGvvlpspeyleelaelarehgallivDeayagfgrtglpfapealgvdivigslsKalg
00440831   1/1  ekaitevgaektkaiileppanptGvlplspadlkaireiadkhgillivDeahaaglaytgklfgseya
00520701   1/1  tklvvlesvnnptGtiaplkeiaeladey...gallivDeahaggvlgrtgrglaehlgvepdadivvgt
00460071   1/1  vphndlealeaalaeatprtkavvvesvfsptGdiap...laeiaelarkhgallivDeahaggvlgrtg
00352461   1/1  dLeklikehgadniaavileptqnptGgqvpsleylkelreiakkhgillilDearlaenayfgfgrtgs
00502611   1/1  pldedgldlealeaalteagadgllpktkavilepnpnnptGvvlppeelealaelarehgallivDeay
00507531   1/1  aleaald...edtaavllehp.nptGvvldlaalaelahaa...GallivDaaqaal..gllvdpgalga
00533351   1/1  aaitea.pktkaiilepnpnnPtGvvlpleeleelaelakkhgillivDeayagfaydlggkgpsllell
00497541   1/1  aleaalte...ktkavilepp.nnptGvvlpleeleelaelarehgillivDeayagfvytgklpvslae
00507541   1/1  vpvdedgridlealeaai...dertaavvltnpnnptGviepleeiaelaheh...gallivDeayaggl
00448071   1/1  tklvilehvnnptGvvlpleeiaelareh...gallivDeaqalgal..pgdldalgvdivvfslhKalg
00364061   1/1  eaalk...ektklivles.snptGvvadlkeiaelahey...gallivDeahaagllgldgrppgel..g
00355891   1/1  prtkaiilenpnNPtGtvldleelealaelarehglllivDeayaglvydgklpgslaeldgvdivlgsf
00416741   1/1  .pktkavilenpnNPtGvvldleelealaelakkhglllivDeayaglvydgkplsalalldalgrvivl
00517571   1/1  psnptgrilsledlkeiaeiakeygallivDeahgaglvggpllpsplelgaDivvgSlhKtl.gGprgG
00494861   1/1  vvltnpnnptGtvyslepleeiaalakehglllhvDgayaggalpglgvsvaeldgaegadvvsfslhKt
00417041   1/1  ii...vvnptGvvadleeiaei...akehgillieDaaqalgalygglk..aggfggadifsfslsKtlg
00421441   1/1  aleaai...dpntklvvlehpnnptGvvlpleeiaelaheh...gallivDaaqaagalpl....dlgel
00465841   1/1  ...tpktklvvlehvsnetGvilplkeiaelakehnGdlsallivDaaqavgalg....ldlaglgvDiv
00459731   1/1  nfsgllf..........kvvfvdvddetgnidledleaaite..pktkaiiv...vasnpGviadleeia
00503901   1/1  itp...rtkaiil.pnpnNPtGavlsreelealaelarkhglllieDeayaelv..ydgkpfpslasldg
00489521   1/1  ...vgvpvdedggldlealeaaie..tpktkavilespnnptGvvldleeiaelakeh...gallivDea
00480741   1/1  ktklvvlehpsnptGvvldleeiaelakeh...gallivDaayaagal..pl..dplelgaDivvfslhK
00401341   1/1  dleaair...prtklivleh.snptGrvadleeiaelahey...gallivDeAhaagllalglhglple.
00500761   1/1  trpvlveitgntetGtvysldeleeiaelcrehglllhvDgArlgnalgalgvdlaeldgaegaDsvsfs
00460871   1/1  idlekleaaikevgapktkliilenpvnpaGgsvysladlkaireiAdkyglllivDaAraagalyaggv
00428061   1/1  alteapektkllllnnp.nNPtGtvlsleelkalaelakehgillvvDeaYagfafggeedapsilelag
00461651   1/1  ........ldlealeaait...pktklvvlenpnnptGvvldleeiaelakel.ghgallivDeayalgv
00451711   1/1  atektkllllnnpnNPtGavlsreeleelaelakehglllivDeayaglvyggeedapsllaladalprv
00465471   1/1  aal...dedtklvvlthpnnptGvilpleeiaelakeh...gpdallivDaaqaagvlpld....ldelg
00460241   1/1  ldaleaaitp...ktklivl.pnpnNPtGtvlsreeleelaelarehgillivDeayaelvydgepkdal
00490701   1/1  lvllthvsnptGvlldieaiaalaheh...GallivDaaq.....aagllpldvgelgaDfvvfsghKtl
00511951   1/1  .spsnptgtvldleaiaelaheh...gallivDeayaag..vlgdplel.gadivvgslsKalggpgdlr
00456391   1/1  ealeaaleeatektkllllnnphNPtGavlsreelkelaelakehdlllisDeaYqgfvydgleedavsi
00393411   1/1  .pktklvll.vnpnNptGtvldleelealaelarehgllvivDeayaela..ydgrpapsllsldpdalg
00487471   1/1  iilehpsnptGtvldleeaiaelakkh...gillivDeayalgvl.gdp..lelgadivvfSfsKalgGp
00506961   1/1  kekgpktkaiilvpnpnNPtGavlsleeleallelarkhdllvieDeayaelv..ydgkpfpslasldep
00474411   1/1  hpenptGvvldlaaiaalare...hgpdallvvDaaqslgalpld.ldel.gvdvvvgslqKalggppgl
00470951   1/1  klvalthvenstGvinpleeiaelaheh...gallivDavqslgalpid....vdelgvDflvssshKgl
00445951   1/1  leedg............flldlealeaai...tprtkaill.vnpnNPtGavldleelealaelarehgl
00354011   1/1  aalteapegglktklvll.pnpnNPtGtvlsreeleellelarehglllivDeayaelvfdgapfpslas
00389521   1/1  alkegpktkalll.pnpnNPtGtvlsleelealaelarkhgillivDeayaelvfdgppfpslasldgal
00375691   1/1  ealeaal....pktklvvl.pnpnNPtGtvlsleeleelaelakhgalvivDeayaelvygg..pllsll
00461541   1/1  tfdatalalsglga...............epvfydvdpetglidpdaleealr...ertpaiivag.vsa
00476701   1/1  vpvdengrmdleaLeeaieedtaaglipaavvatagttptGai...dpleeiaeicrehgiwlhvDaAyg
00367801   1/1  lvlle.spsnptgtvldleeiaelahe..nhgalvivDeayaag.vlld..plelgadivvgslsKylgg
00521641   1/1  leaalee..pdtklvalthvetstGvllpleeiaelaheh...gallvvDavqslgalpid....vdelg
00380341   1/1  ...tprtklvvlespsnptgtvadleaiaelahkh...galvivDeayatgvl.gd..plalgadivvgs
00473401   1/1  ...tprtklvllespsnptGtvldleeiaelaheh...galvivDeayaag.llgd..plelgadivvgs
00513231   1/1  tp...ktkliil.nnpnNPtGtvlsreelealaelakkhglllisDeayaelvydgapftsllslpdald
00479561   1/1  lcnpnNPtGavlsreelealaelarehgillivDeayadlvydgasfvslaslldnvivlrSlsKafgla
00469651   1/1  ...pktkaill.pnpnNPtGavlsleeleelaelarehgllvieDeayaelv..ydgkpapslasldgll
00423831   1/1  ...talvvatagttptGaiddieeiaelaeeygletglgiwlhvDaAyggfllpfleklrpldfglpgvd
00358461   1/1  peglrplpktkavvltnp.nptGtvypleeiaelak...khglyllvDeAhgagayggpgrglaehlglp
00495241   1/1  rllaerlGaevvfvdvde.dglidlealeaai...tpkTklvalvhpsnptGvvlpleeiaelaheh...
00450681   1/1  llaalteapektkllllnnpnNPtGtvlsreelkelaelakehglllivDeaYqgfaydgldedalavrs
00507681   1/1  lvpnpnNPtGavlsleeleallelarkhdllvieDeayaelvydgapfpslasl..dapdrvivlgsfSK
00460561   1/1  lthvsnvtGvilplaeiaalaheh...galvlvDaaqaagalpl....dlgelgaDfvvfsghKl.lGpp
00412601   1/1  spnNptgtvldleeiaelakkhllnpgalvvvDeayatp..vlgd.plelgadivvhSlsKalggagdlr
00350731   1/1  ldldallaalesatektkllllnsphNPtGtvltpeelkelaelakehgllvivDeaYqgfayggleeda
00408971   1/1  .pvnptGavadleaiaelareh...gllvivDaahalgalyggrhpgslgadivsfsasKtltggggGav
00452311   1/1  pnNPtGtvltpeelkelaelakehgllvivDeaYqgfayggldedapsllalleagenvivlrSfSKafg
00509771   1/1  P..nNPtGtvlsleeleallelarkhgllvisDeayaelvydg.pfpslasldgydrvivlgsfSKtfgl
00357001   1/1  ..idpdtklvalthnetstGvlnpl........lakkhgallivDavssilarpidvd....klgvdyas
00528621   1/1  -----GtvlsleelealaelarkhglllivDeayaelvfdgepppsl.ldalgrvivlgsfSKtlglpGl
00523021   1/1  de................dlealeaait...pktkaiilehpsnptGtvadleaiaelakkh...gilvi
00475811   1/1  slentqntegGtvypleeleeiaelArehglllhlDGARlanalvalgvslaelag.lvdsvsvglsKgl
00460891   1/1  npnNPtGavlsreelealaelarkhdllvisDeaYadlvfdgapfpslasllpdlydrvivlrslSKtfg
00445231   1/1  --------vlsreelealae...hgllvvsDeaYadlvyd..salllleaydnlivlrsfSKafglaGlR
00462061   1/1  vvtfvdg................ldlealeaaite...ktkliflespsNptgtvldlaaiaelAhev..


                         -         *         -         -         -         -         +:350
query           AGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEENPGYYRYLEDLGARLERGLKEVLAQKGIP
00529431   1/1  vlgsaeimdalapggpglhggtfsgnplacaaalaalellee.edllerlaelgeylregleellakhpl
00428091   1/1  ivtlsKalgggglplgavlgseeiadalapgalgaflhggtfggnplacaaalaalellee.edllerla
00516011   1/1  tlgKalggGlPlgavlgskeimdalrp.gsflhggTfsgnplacaaalaaleileee.dllerlaelgey
00521571   1/1  vlgseeiadalrplgpglhgstfsgnplacaaalaalellee.egllerlaelgaylregleellakhpl
00435831   1/1  aKglggGlPlgavlgsaeimdalap...llhggtfggnplacaaalaaldvlee.egllerlaalgeylr
00453921   1/1  Kalgggglplgavlgseeiadal...gpllhggtfggnplacaaalaalellee.eellerlrelgdyll
00515171   1/1  glggGylPlgavlgskeimdaf...gpglhggTfggnplacaaalavleileeed.llenvaelgeylle
00485711   1/1  lepvqnptGvvlppeeylkelrelarkhgillivDeayagfgrtgkpfalellgvddrpdivtlshKalg
00467471   1/1  tGrgllehlgvlpdadivtgtlsKalggg.rgGailgskelidklrslarpgifst.slnplaaaaalaa
00501571   1/1  gglglGavlgsdeladalrplr...rgltfggnplaaaaalaalellee.eelrerlreladylaegLae
00440831   1/1  gvaigelvpdlfggadivsfslsKtlggp.rgGailtndeeladklrklrfpgegfplgggyrgspiaaa
00520701   1/1  lhKal..GprgGalagseelidalrplargg...tfsgtlnplaaaaalaalellgeegleelrerlral
00460071   1/1  rgllellglgadivvgtlsKalGg..rgGavlgseelidalrplargg...tfsgslnplaaaaalaale
00352461   1/1  lfaleiagivpdiltladvvtfslsKgggapgGgvlatgdkelieklrrlrkvlgegffthgglagagpl
00502611   1/1  agfvytgkpagslaalde.lgvdivlgslsKtlggglrlGalvgdeelieal...rklrhggtftgnpla
00507531   1/1  divvgslhKllgPhglggpgaGalavreellralpgrlvgvtgdadgkralrlalqtreqhirrekgtsn
00533351   1/1  dlgpdvivlgSfsKalglpGlrvGalvgpdeellllallieal...rklrrpgtgspsplaqaaaaaale
00497541   1/1  llgvagadivvgSfsKalglpGlrlGalvgdeelidal...rklrrggtftlsplaqaaalaaledleeh
00507541   1/1  glgvdpgdl.g..aDivtlslhKtlggpkgggGprlGallvrdelaealplrlggggergfvltldreqa
00448071   1/1  gglglGallvseellerlr...pllsggtslyldlllllkyeqerrfragtpnplaaaallaalelllee
00364061   1/1  aDivtgslhKtl.gGprgGyiagkdelqelieklrrlkaplgfgt.alspliaaaalaalelleegleel
00355891   1/1  sKalglpGlrlGylvadpeliealrk...lrsggtlgpsplaqaaaaaaledlelleehleelrerlrer
00416741   1/1  gSfsKalglpGlrlGylvadpeliealrk...lrsggtfgpsplaqaaaaaaled..eleelrerlrerr
00517571   1/1  yiagkkelieklrk...vfpglggspsplvaaallaalktlllrgfkryleealklakalaeylyeglkk
00494861   1/1  lggpg.gGallvrdelaealpllrgggg.etgrrsgllaaaalaalg.legleelaarlreladylaegL
00417041   1/1  gg.ggGalltndeelaerlrplrlggisidlkylvqelgfnsgtspiaaaaglaaleglee...ilerrr
00421441   1/1  gaDivvfsahKyl.ggpglGallvrdellerlr...pllhggglekrfeagtpnplaiaallaalellg.
00465841   1/1  vfslhKalggpggiGalyvrkelldrlrpllhgggslilvvrfdsltlqelglrfefgt...ppvaaaaa
00459731   1/1  eiakkh...gallivDaAhalgavgldvlpgplg.gaDivsfslhKtlggp.pGGallvndelieklrpl
00503901   1/1  eygrvivlgSfsKtlglpGlRlGyvvappeliealr...klrsaltlgvsplaqaaaaaaledgelrler
00489521   1/1  yaggal..gdplel.gadivvgslsKalggpaGlrgGalvgndeliealrklrs...ggggtlsplaaaa
00480741   1/1  alggppgvGallvrkelieklrpllpgglldlvlalkylgavlgfftgtpnilgiaalaaalellgeeg.
00401341   1/1  gadivvgslhKtlgGp.rgGailvrdelaeklrsllfgg...gfggtlspllaaallaalelleeglker
00500761   1/1  lhKglgapgggallgrdeliekarllrkrlggllrqagllaaaalaalge.egleellaranalarrlae
00460871   1/1  tgspyafrsigeivdeifgyadivsfslsKglggprgGaivtndeelakkarklrfpgegfllgggprqh
00428061   1/1  agpnvivlgSfsKtfglaGlRvGylvapaeliealakvlsqlklliraltsnppalaqaaaaaalsdgel
00461651   1/1  lgdplel...gadivvgslsKtlngpgGlrgGalvgndeliealrk...vrrglggtlsplaaaallaal
00451711   1/1  ivlgSfsKtfglpGlRvGylvappeliealakvksqllllirgltlnpptlaqaaaaaaledgalreewe
00465471   1/1  vDfvvfsghKal.gppgiGalyvrkell.....lrpllvgggqerrfeagtpnvlaiaalaaalellgeg
00460241   1/1  ppslasldglgrvivlgsfSKtfglpGlRlGylvapeeliealrklkgggllraltlsvstlaqaaaaaa
00490701   1/1  gggppglGflyvreellerlp..pllfgggtvadsfyldltlqpaeqerrfeagtpnvaliaalaaalel
00511951   1/1  gGylvgseeliealrklllggglg.gtlspaaaaaalagletl...eerrarlrenadrlaeaLael...
00456391   1/1  aslaelgdrvivlnsfSKtfglpGlRvGylvapnkdaelakelisalkk...lkrpltsnpptlaqaaaa
00393411   1/1  rdivvfSfsKtlglpglrvGylvadpeliealrklrsgg...gstpsplaqaalaaaledgeehleelre
00487471   1/1  tGlrgGalvgndelieallkllrggg.gggtlsplaaaallaaletl...eerlerlrenadllaeaLee
00506961   1/1  drvivlgSfsKtllpGlRlGylvappeliealrklrs...gltlgvstlaqaaaaaaledggyeehleel
00474411   1/1  Gflavspellerlep...lsgylglallldlqekrfepgtppvlaiaallaalellleegle.rrarlae
00470951   1/1  ggppGlGflyvsekalerlknrklpplsgggdlllllkfmladqerrfeagTppvaliaalaaalellle
00445951   1/1  lvieDeayaelv..ydgpfpsladlda.grvivlfSfsKtlglpGlrvGylvappeliealrklrslg..
00354011   1/1  lllelglrllpdaygrvivlgsfsKtlglpGlRlGylvappeliealrk...lksa.tlsvstlaqaaaa
00389521   1/1  lllpldlgrvivlgSfSKtlglpGlRlGylvakppeliealrklrsp.....lsvsslaqaaaaaaledg
00375691   1/1  dllgrvivlgslsKtlglaGlRvGylvappeliealrklrsp.....lgvstlaqaaaaaaledgllehl
00461541   1/1  ygrladlkelreiadev...gallivDaAhaaGlvaagvlpspfg.gadivtftthKtlrGp.rgGailt
00476701   1/1  ggalpfpeyrllldgiegaDsitfslhKwlgvplgcgallvrdkellrralsvdadylgslddggdgvrd
00367801   1/1  pgdlrgGyvagseeliealrklrpggglg.gtlspaaaaallrgletl...elrreraqenadylaelLe
00521641   1/1  vDllvasahKglggppGlGflyvsedllerleplllgggslyldlkllldyllayqergfeagTppvali
00380341   1/1  lsKalggpgdrlgGyvvgsdeliealrklrlgggfg.gtlspaaaaallrgletl...elrrarlrenad
00473401   1/1  lsKyl.gghgdlraGylagreelidklrgllvglgggt..lspaaaaallaaletl...elrreralena
00513231   1/1  rvivlrSfSKtfglpGlRvGylvappeliealrk...lksalglgvstlaqaaaaaaledgllglegdee
00479561   1/1  GlRlGylvappeelieallklrs.....plgvstlaqaaaaaaledgeyleelrarlrerrdllaealee
00469651   1/1  drvivlgSfsKtfglpGlRlGylvappeliealrklrspg...nssvstlaqaaaaaaledgeflehlee
00423831   1/1  sisvsghKyglaplgcGvvlvrdkellrealsvnadylggdlgsftlegsrpgaralalwaallslgre.
00358461   1/1  plaleagadivvgslhKtlgaltqtGwlhvrggyiagpkelidalrfnraysllyst.spsyplqaalla
00495241   1/1  galvivDaaqaagalpid..ldelgaDfvvfsahKwl.gppGiGalyvrkelldkllpllrggggivlvs
00450681   1/1  flelldagdnvivlrSfSKtfglaGlRvGylvappevvladaellaalisallklkraltsnpsslaqaa
00507681   1/1  tllpGlRlGylvappeliealr...klrslltlgvsslaqaaaaaaledglydehleelrallrerrdll
00460561   1/1  GvGflyvrkellerlppllvgggqvaavsldlalqlrllerrfeagtpniagiaallaalellgeeglea
00412601   1/1  iGyvvgndelidalrklrgp.....ltgstlspaaaaaalrgletlelrrerlaenaallaeaLeelgpg
00350731   1/1  tsirslvelgenvivlnSfSKnfglaGlRvGylvappelieallr...vksqlkllirslysnpptlgqa
00408971   1/1  vtndeelaerlrklrnhglsrgllllvlaalllryevlllgynyrlspiqaaallaale...tlderler
00452311   1/1  laGlRvGylvappelieallkvlsqlklliralpsnpptlgqaaaaaalsdpelralwleeleemrerla
00509771   1/1  pGlRlGylvavgppelieallkllllkslltlgvstlaqaaaaaaledgeehleelrarlrerrdllvea
00357001   1/1  aqKnlGpp.GlgvvivsedllerlepilpgyldyktvakngstanTp..ptlaiyalgaalewlleeggl
00528621   1/1  RlGylvappeliealrklkspl...tlgvsslaqaaaaaaledgeehleelrerlrerrdlllealkelg
00523021   1/1  vDeaqatggllydg..lelgadivvfSfsKylggtGdrlGglvvtndkelierlrplrsggtsisyvglv
00475811   1/1  gapvGavlvgdkdliekarrlrkrlggglrqagvlaaaalva....ledllellaeaherakrlaegLse
00460891   1/1  lpGlRlGylvapnpeliea...llklkspltlglvstlaqaaaaaaledgeeyleelrarlrerrdllle
00445231   1/1  lGylianpeliealrklrsp.....lnvstlaqaaaaaalsdldyleelrerlrerrdllveaLael...
00462061   1/1  .gallvvDntyaapll.....ldpldlgadvvvhsttKklgghggvrgGylvgnpellaallkvlp----


                         -         -         -         -         *         -         -:420
query           HAVNRVGSMVTVFFTEGPVVTFQDAKRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHTEEDVEKTL
00529431   1/1  vgdvrglGlmlglelvkdkgtnilfvllpdaelaaalaaallerGvlvrpggvlrllpplaiteedidel
00428091   1/1  elgarlregleelaa.hplvgdvrglglmlgielvdd.............elaaalakalleeGvllrpg
00516011   1/1  lregleellaglplvgdvrglgliigvelvddkatke.....pdlelaaalaeallerGvlvrpigfptv
00521571   1/1  vgdvrglGlmlglelvadkgtnivfvllpdaelaaalaaallerGvlvrpgnvlrllpplaiteedidel
00435831   1/1  dgllellakhplvgdvrglGlmlgielvddkltkepla.....elaaallrlllerGvllrpgglfgnvl
00453921   1/1  egleell..lplvgdvrglGlmlgielvsd...........dgllalalaalllerGvllrpgggnvlrl
00515171   1/1  gleelaakhplvgdvrglglmlgielvddkatkaal..........llllllllllllgpggnvirllpp
00485711   1/1  .G...Gav.gseelidalrpl....hggtfsgnplaqaaalaalellee.eellerlreladylregLae
00467471   1/1  lelleegeelrerlrenaeylregLeel....glpv.gpsdghivlvdl.............gdgllaka
00501571   1/1  l....glelvgpvrggglflfvel..............pggdaealakalleeGvlvrpggpgvlRlsps
00440831   1/1  aallalellee...llerrvenakylaeaLeel....gvpvv.gpvgghgvfldlellldgitgde....
00520701   1/1  aaylaegLael....glpvv.gglgaivlvdlgdgvdaka.............laaallleaGilvrpgs
00460071   1/1  lleeegleelrerlaelaarlregLael....glevv.pglglivpvelgdg.............ldala
00352461   1/1  alaaglaelel....edllarvienanylaeaLeel....gvpvvtp..vgghgvfldlelvldpipgdq
00502611   1/1  qaaalaaledlaleehleelrarlrerrdrlaeaLeellpdlpglevvgpggglflwvdl..........
00507531   1/1  ictpnglaaaaalaaldllgleglearaeralalanylaaaLeel...pgvrvlgpggaghevsfdl..g
00533351   1/1  dlelrghwlaeleelrerlrerrdllleaLkellpllgvsvvlpsgglflfvdlp...............
00497541   1/1  leelrerlrelrdrlaeaLeel....glevlvpggglflwvdlpdl...........lgvdaeelaeall
00507541   1/1  irr...glagtgnalaiaaaaaalrllgeeglkelaerlveladylaegLkel...pgvevvgpggghlv
00448071   1/1  glealrarlaeladylaegLeel.glelvgppgrrsgllvsfdlpd.............gvdaeelakaL
00364061   1/1  aerlvenaaylaegLkel....gfvvvvgppgghivlvdlpg...........dgidakalakaLeeagi
00355891   1/1  rdrlaealaelglevvgpggglflwvdlpdl............gldaeelaealleagvlvrpgsafggp
00416741   1/1  dllaeaLeel....glevvgpsggfflwldl............p.g.ldaeelaealleagvlvrpgsaf
00517571   1/1  lpglegfkvvspgggnilsfilpvdl.........gdgidalelaklllelygiavspgshpgvpdgliR
00494861   1/1  ael....glelvgppganivfvdlpgvdaee..............laaalleagiavspggpgalRlslg
00417041   1/1  eladylaeaLkelpglelvgppglsaphlfpvllplpeltelllplgglllwlfllegidreelakalle
00421441   1/1  eglealraralelaeylregleel...pglelvgppgrrlggivsfel...........pgvdaedl...
00465841   1/1  lgaalelleeeglleairerlreladylregLeel...pglelvgppggrgpivsfelpg..........
00459731   1/1  rvgglfdlekligrarryffsgtppgarlaalaaalgllglegleerlerrrelakylaegLke.lglev
00503901   1/1  leehleelrarlrerrdllaealeelglkvvppeggfflwvdlpelllkalalllllggldaeelaeall
00489521   1/1  llaale...gleerrerlrenadylaeaLaelggvelvlppglpshpghylavrlprglglllsfelp..
00480741   1/1  gleeilerlreladylyeglkelglellgpdgrgrggivsfrlp..........dgidaa.akalakall
00401341   1/1  rerlvenaarlaeaLeel....gfvvvvgppdghlvsvdlpgl...........gidaldlakaLeeagi
00500761   1/1  gLaal...pglelvgppetnivffrlpg..............e....llerllergiavspgsagpgvlR
00460871   1/1  giaaaaallalaelee...ylerrhenarylaeaLkel....gipvv.gptgghlvfvdlrkllphipgd
00428061   1/1  lelwleeleelrerlaerrdllveaLaelggpgdldvikpqggfflfldlpd................--
00461651   1/1  ...egleerrerlrenadrlaeaLael...pgvervlypglpphggfflwvdlpegrgglvsfrlkdgid
00451711   1/1  eeleelrarlrerrdllvealaelplpgglevvvpqggmflwldl.............pd....efvlrl
00465471   1/1  leairarlleladyllegLkel...pglellgppgrrgnivsfrlp.g..vdaed...........laka
00460241   1/1  ledgleehleelrerlrerrdllaealeel...pglevvppeggfflwvdlpelllk........tglda
00490701   1/1  lglegleaiaarhleladylaegLaalpavpglellgppdaarrgglvsfrlpg................
00511951   1/1  ...........ggvalvgypglpshpghelakkvlpgrggfvsfdlpg..ggedaeafadaLkeagiavs
00456391   1/1  aalsdpelreewleeleelrerlkerrdllveaLkklptpggldvikpqggfflfldlpd..........
00393411   1/1  rlrerrdllaeaLael...pgvevvgppggfflwvdlpgl............gldaeelaeaLleeagva
00487471   1/1  l...pgvtlvlypglpshpghelakklvpggggllsvel.............kdgedaeelldalkeagi
00506961   1/1  rarlrerrdlllealkellp.pglevvppeggfflwldl.............pegldaeelaealleegv
00474411   1/1  ladalragleal....glell.pegrsggvvsfrlpd.............gidaaalakaleeagiavsp
00470951   1/1  eGleairarhreladalreglealglellgpdpaarspgvvsfrlpeg.....vdaeellaallerygia
00445951   1/1  .glgvstlaqaaaaaaledglflehleelrarlrerrdllleaLael....glrvlkpeggfflwldlp.
00354011   1/1  aaledgelleehleelrerlrerrdllleaLeelglevlppegglflwvdlpelllkl.......gglda
00389521   1/1  gfleehleelrerlrerrdllleaLee....pglevlppegglflwvdlpalllk.......ldgldaee
00375691   1/1  eelrerlaerrdllleaLeel...glvsvvgpsgglflwvdlp................daeelaealle
00461541   1/1  rdelldellrllrgfgfdlakkinsavfpglqggplnhviaalaaalklaqleefkeyaeqvvanarala
00476701   1/1  lrdftlegsrrfralklwaalralgre.glrelierlielarylaegLrelpgfellgepelglvvfrlk
00367801   1/1  elglvvlvyypglpsgafyllaklp.akgrggllsfelkg..daeavaklld...elgvavrpgslggve
00521641   1/1  yalgaalellleegleairarhreladalreglealglellgpdpelrspgvvsfrlpeg..vdaee...
00380341   1/1  llaeaLaelpgvvlvlypglpshpghelakrqlpggggivsfelkg............dgedaeafadaL
00473401   1/1  dylaelLaelpgvylvgypglpshpghelakkvlpgrggfvsfdlkg............gvd.aealada
00513231   1/1  hleelrerlrerrdllaeaLeel....g.lkvlppeggfylwvdlpelllalkllkglggldalelaerl
00479561   1/1  l....glkvlkpsggfflwldlp...............ldaeelaerlleegvlvrpgsafgllgegylR
00469651   1/1  lrerlrerrdllleaLael....glevlppeggfflwvdl.............pelgldaeelaerllee
00423831   1/1  gyeelverilelarylaelLeklggfellsdgepalpvvafrlkpg......dallplldaad.lserll
00358461   1/1  alellageegeelrerlieladylrkaLkklgflflpsdspivpvilpegafylfakiddfalllleeag
00495241   1/1  lfgltaaeqerrfeagtpnvaaiaalaaalellqeegleairerhreladyllegLkelpgvllvgppga
00450681   1/1  aaaalsdgellaewleeleemrerlkerrdllveaLrelglpgdlsvikpqggfflwvglpe........
00507681   1/1  leaLeellp.pglkvlppeggfflwldl.............pdgldaeelaealleegvlvvpgsafglg
00460561   1/1  irarlraladylaegLaalpglellgp..errggivsfrlp.g.............vdaedlakaldeyg
00412601   1/1  vevvlypglppegahylalrvlklpgaggivsfelkg.......daealaalldel...giavrpgslgg
00350731   1/1  aaaaaLsdpelraewleeleemrarlkerrdllveaLeklggpgdldvilpqggmflfvglpd.......
00408971   1/1  rrenadrlaelLaelpgvelvkppglsshafylfailvlllglg.............ldrdelaeaLeea
00452311   1/1  errdllveaLkelggpgdldvilpqggfflfldlpd.................efverlleeagvavvpg
00509771   1/1  lee.lp..glevlkpsggfflwldlpel...........gledaeelaealleeagvlvrpgsafgllgp
00357001   1/1  eaiearhaelaallyealdalglvyllvvdpelrsgmvvsftlpdg.............vlakaflkllk
00528621   1/1  g...lsvvkpsggfflwldlpell........llggddaeflarllleagvlvrpgsafgllgspgpgyl
00523021   1/1  tldllprrfeagtpnvagliglgaalsplqaalllrgletldl...rlerrrenadylaegLaelpgvel
00475811   1/1  l....ggvtlvlpvetnmvfvrlpgaaidalellellleegvll.........vplgpglvRlvthldvs
00460891   1/1  alkellp..glkvlppegafflwldlpel............gldseelaerlleeagvlvvpgsafgllg
00445231   1/1  .glevlppeggfylfldls...............ldaeelaerlleegvlvrpg.pgylRislatpeend
00462061   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EALGEAL---------------------------------------------------------------
00529431   1/1  lealeea---------------------------------------------------------------
00428091   1/1  g.nvlrl---------------------------------------------------------------
00516011   1/1  gnvlrls---------------------------------------------------------------
00521571   1/1  lealeea---------------------------------------------------------------
00435831   1/1  rlrppli---------------------------------------------------------------
00453921   1/1  spplait---------------------------------------------------------------
00515171   1/1  liiteee---------------------------------------------------------------
00485711   1/1  llaklpg---------------------------------------------------------------
00467471   1/1  laeaLle---------------------------------------------------------------
00501571   1/1  latteeei--------------------------------------------------------------
00440831   1/1  .......---------------------------------------------------------------
00520701   1/1  apavplg---------------------------------------------------------------
00460071   1/1  laealle---------------------------------------------------------------
00352461   1/1  fpaaal..--------------------------------------------------------------
00502611   1/1  ...pdglda-------------------------------------------------------------
00507531   1/1  .......---------------------------------------------------------------
00533351   1/1  ..aeala---------------------------------------------------------------
00497541   1/1  eeagvl----------------------------------------------------------------
00507541   1/1  afdlpp.---------------------------------------------------------------
00448071   1/1  leeygiav--------------------------------------------------------------
00364061   1/1  avrpgsf---------------------------------------------------------------
00355891   1/1  gylRlsl---------------------------------------------------------------
00416741   1/1  ggpgllR---------------------------------------------------------------
00517571   1/1  lsvgslg---------------------------------------------------------------
00494861   1/1  latte-----------------------------------------------------------------
00417041   1/1  agiavrpg--------------------------------------------------------------
00421441   1/1  ..lller---------------------------------------------------------------
00465841   1/1  ...gvd----------------------------------------------------------------
00459731   1/1  lgpglds---------------------------------------------------------------
00503901   1/1  eeagvlv---------------------------------------------------------------
00489521   1/1  .......---------------------------------------------------------------
00480741   1/1  eagiavs---------------------------------------------------------------
00401341   1/1  avrlgsh---------------------------------------------------------------
00500761   1/1  lvtslat---------------------------------------------------------------
00460871   1/1  tglsgal---------------------------------------------------------------
00428061   1/1  ----------------------------------------------------------------------
00461651   1/1  aealaka---------------------------------------------------------------
00451711   1/1  l---------------------------------------------------------------------
00465471   1/1  llekgia---------------------------------------------------------------
00460241   1/1  eelaerl---------------------------------------------------------------
00490701   1/1  aealaka---------------------------------------------------------------
00511951   1/1  pgsafslv--------------------------------------------------------------
00456391   1/1  .---------------------------------------------------------------------
00393411   1/1  vrpgsaf---------------------------------------------------------------
00487471   1/1  avslgsa---------------------------------------------------------------
00506961   1/1  lvrpgsa---------------------------------------------------------------
00474411   1/1  gsaflag---------------------------------------------------------------
00470951   1/1  vsagsac---------------------------------------------------------------
00445951   1/1  .......---------------------------------------------------------------
00354011   1/1  eelaerll--------------------------------------------------------------
00389521   1/1  laerlle---------------------------------------------------------------
00375691   1/1  egvavrp---------------------------------------------------------------
00461541   1/1  eaLael...-------------------------------------------------------------
00476701   1/1  pa.....---------------------------------------------------------------
00367801   1/1  slvihpal--------------------------------------------------------------
00521641   1/1  .......---------------------------------------------------------------
00380341   1/1  keagi-----------------------------------------------------------------
00473401   1/1  Leeagiav--------------------------------------------------------------
00513231   1/1  leeagva---------------------------------------------------------------
00479561   1/1  lslg.se---------------------------------------------------------------
00469651   1/1  agvlvrp---------------------------------------------------------------
00423831   1/1  ergwvvp---------------------------------------------------------------
00358461   1/1  vavvpgs---------------------------------------------------------------
00495241   1/1  syrlpvt---------------------------------------------------------------
00450681   1/1  ....------------------------------------------------------------------
00507681   1/1  glgpgyl---------------------------------------------------------------
00460561   1/1  iavrtgs---------------------------------------------------------------
00412601   1/1  vesliih---------------------------------------------------------------
00350731   1/1  ....------------------------------------------------------------------
00408971   1/1  giavvpgy--------------------------------------------------------------
00452311   1/1  srfg------------------------------------------------------------------
00509771   1/1  gylRlsf---------------------------------------------------------------
00357001   1/1  eegiavl---------------------------------------------------------------
00528621   1/1  Rlsfats---------------------------------------------------------------
00523021   1/1  vlypglps--------------------------------------------------------------
00475811   1/1  eedvdeal--------------------------------------------------------------
00460891   1/1  egylRis---------------------------------------------------------------
00445231   1/1  rle-------------------------------------------------------------------
00462061   1/1  ----------------------------------------------------------------------