[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS80932.1


[Show Plain Result]

## Summary of Sequence Search
   1::283
   8::282  9.1e-63 35.3% 0042544 00425441 1/1   DegV-like                               
   7::282  5.4e-62 35.1% 0040914 00409141 1/1   DegV-like                               
   1::283


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MASTPTASSVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQV
00425441   1/1  -------mkiaivtDStadlpkelleelditvvplsviidgetyldgvdisleefyeklkegelpkTsqp
00409141   1/1  ------mmkiaivtDStadlpkelleelgitvvplsviidgetyldglgvdisleefyeklkesgelpkT


                         -         -         *         -         -         -         -:140
query           APEDLRKLYEALLRTHGRVVSVHVSGLLSGTVDTAKKVAQAFGERVKVLDSWSLSGGLLLVLERARRLLE
00425441   1/1  spgeflelfeellegydevlsltlssglSgtynsallaaellleeypdlkvtviDsklaslglgllvlea
00409141   1/1  sqpspgeflelfeelleegydevlsltlssglSgtynsallaaelldlkvtviDsklaslglgllvleaa


                         +         -         -         -         -         *         -:210
query           EGVAWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
00425441   1/1  aelaeeGksleeilealeelrektllyfvvddLdyLvkgGRiskaaallgslLnikpiltvddgklvlva
00409141   1/1  elaeeGksleeilealeelrekketllyfvvddLdyLvkgGRiskaaallgslLnikpiltvddgklvlv


                         -         -         -         +         -         -         -:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPEGAKALGEALKAGGVEVLGALPAGAAVSVHTGPGTVAAFAG
00425441   1/1  kvrglkkalekllelllelikdgkllrvailhagdlelaeelkellkeklplveililligpvigvhtGp
00409141   1/1  akvrglkkalekllelllelikdggllrvailhagdlelaeelkellkeklplveilisligpvigvhtG


                         -         *         -         -         -         -         +:350
query           PRG-------------------------------------------------------------------
00425441   1/1  ga--------------------------------------------------------------------
00409141   1/1  pg--------------------------------------------------------------------