[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81022.1


[Show Plain Result]

## Summary of Sequence Search
   1::434
  89::295  6.1e-56 45.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  90::294  1.8e-50 38.2% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  87::295  3.2e-50 37.3% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
  90::294  6.3e-50 42.0% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  95::294  2.1e-48 39.0% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  99::303  1.4e-44 31.9% 0037385 00373851 1/1   p containing nucleoside triphosphate hy 
  98::308  9.6e-41 30.4% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  93::293  1.7e-39 34.3% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
 295::421  5.2e-39 54.3% 0043060 00430601 1/1   l peptide-binding domain                
  93::312  3.3e-35 35.2% 0037384 00373841 1/1   p containing nucleoside triphosphate hy 
 319::422  4.1e-34 58.0% 0045276 00452761 1/1   l peptide-binding domain                
 319::418  1.2e-32 56.0% 0042692 00426921 1/1   l peptide-binding domain                
 319::421  1.7e-32 56.3% 0038671 00386711 1/1   l peptide-binding domain                
  99::316  2.1e-28 28.4% 0036095 00360951 1/1   p containing nucleoside triphosphate hy 
  22::259  6.4e-28 26.0% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  96::350  3.9e-26 27.6% 0046842 00468421 1/1   p containing nucleoside triphosphate hy 
  96::303  8.2e-25 27.8% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   1::94   2.7e-23 39.4% 0050537 00505371 1/1   n of the SRP/SRP receptor G-proteins    
  68::296  3.2e-23 30.2% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
   1::88   3.6e-23 40.9% 0048024 00480241 1/1   n of the SRP/SRP receptor G-proteins    
  99::303  4.7e-22 24.4% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
 320::420    2e-21 65.2% 0036607 00366071 1/1   l peptide-binding domain                
  57::308  2.1e-21 28.6% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
   5::91   8.2e-21 42.5% 0043059 00430591 1/1   n of the SRP/SRP receptor G-proteins    
  97::292  2.7e-20 31.7% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
   5::88     3e-19 36.9% 0039423 00394231 1/1   n of the SRP/SRP receptor G-proteins    
  98::252  1.3e-18 27.5% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  98::351  7.3e-18 29.9% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
  86::291  1.1e-17 29.8% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  96::313  1.6e-17 24.8% 0046913 00469131 1/1   p containing nucleoside triphosphate hy 
  99::266  1.1e-16 26.9% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  99::259  2.3e-16 22.6% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
 102::268  5.8e-16 33.5% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  26::285  3.3e-15 28.8% 0042471 00424711 1/1   p containing nucleoside triphosphate hy 
 100::229  9.8e-15 25.8% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   1::91   1.5e-14 34.9% 0037775 00377751 1/1   n of the SRP/SRP receptor G-proteins    
  96::280  2.2e-14 25.1% 0047406 00474061 1/1   p containing nucleoside triphosphate hy 
  96::202  3.9e-14 30.2% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  73::253  6.3e-12 30.9% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  26::104  1.9e-11 39.7% 0043267 00432671 1/1   n of the SRP/SRP receptor G-proteins    
  83::251  7.5e-11 27.4% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
  93::219  1.9e-10 25.8% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  99::236  2.2e-10 31.1% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  87::252  4.1e-10 29.8% 0036699 00366991 1/1   p containing nucleoside triphosphate hy 
  96::240  7.7e-10 27.3% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  60::254  2.3e-09 29.0% 0046711 00467111 1/1   p containing nucleoside triphosphate hy 
  93::248    4e-09 25.2% 0037407 00374071 1/1   p containing nucleoside triphosphate hy 
  94::250  4.6e-09 25.9% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  56::218  7.8e-09 28.9% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  82::270  1.8e-08 29.2% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  67::281  1.2e-07 25.3% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  94::217  2.3e-07 30.8% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  95::249    3e-07 19.2% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  98::219  5.1e-07 26.5% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
  91::220  6.7e-07 33.6% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
  93::217  6.9e-07 26.8% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  49::218  1.1e-06 26.8% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  98::217  1.1e-06 31.1% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  23::217  1.3e-06 27.0% 0052796 00527961 1/1   p containing nucleoside triphosphate hy 
  93::217  1.4e-06 25.9% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  96::217  1.5e-06 23.1% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  31::233  2.7e-06 27.3% 0038151 00381511 1/1   p containing nucleoside triphosphate hy 
  94::245  2.7e-06 28.9% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  14::187  3.3e-06 27.4% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
  62::218  3.8e-06 29.9% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  53::218  4.6e-06 28.5% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  26::70   5.5e-06 42.2% 0041903 00419031 1/1   n of the SRP/SRP receptor G-proteins    
  11::233  2.7e-05 26.8% 0038141 00381411 1/1   p containing nucleoside triphosphate hy 
  57::218  2.8e-05 25.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  83::252  3.2e-05 28.8% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  93::220  4.2e-05 27.4% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  98::215  4.7e-05 23.7% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  60::218  4.8e-05 25.7% 0049491 00494911 1/1   p containing nucleoside triphosphate hy 
  54::218    5e-05 27.4% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  74::205  5.2e-05 28.8% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  58::218  5.5e-05 26.7% 0047665 00476651 1/1   p containing nucleoside triphosphate hy 
  93::217  5.8e-05 27.0% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  95::222    7e-05 24.0% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  59::334  7.2e-05 24.6% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  74::223  7.5e-05 24.8% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  99::220  8.8e-05 28.0% 0047772 00477722 2/2   p containing nucleoside triphosphate hy 
  92::248   0.0001 29.2% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  90::226  0.00013 25.9% 0037248 00372481 1/1   p containing nucleoside triphosphate hy 
  75::248  0.00015 24.8% 0051784 00517841 1/1   p containing nucleoside triphosphate hy 
  92::217  0.00015 27.8% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  52::332  0.00023 26.6% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  91::220  0.00025 31.2% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
  77::218  0.00028 29.8% 0046258 00462581 1/1   p containing nucleoside triphosphate hy 
  53::195  0.00029 23.1% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  83::219   0.0003 33.0% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  96::248  0.00032 24.4% 0036239 00362391 1/1   p containing nucleoside triphosphate hy 
  52::205  0.00033 24.0% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  94::248  0.00038 28.1% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  77::233  0.00041 23.9% 0037955 00379551 1/1   p containing nucleoside triphosphate hy 
  95::222  0.00044 23.4% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  99::220  0.00046 26.8% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  51::218  0.00053 29.1% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
 100::217  0.00063 26.6% 0048702 00487022 2/2   p containing nucleoside triphosphate hy 
  96::248  0.00074 25.9% 0046936 00469361 1/1   p containing nucleoside triphosphate hy 
  94::252  0.00083 32.5% 0044482 00444821 1/1   p containing nucleoside triphosphate hy 
   5::89        11 27.1% 0048702 00487021 1/2   p containing nucleoside triphosphate hy 
   5::83        13 27.5% 0047772 00477721 1/2   p containing nucleoside triphosphate hy 
   1::434


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLEVARAFVEEVRERALGRKVLESLTP
00480251   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00430601   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00452761   1/1  ----------------------------------------------------------------------
00426921   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00371631   1/1  ---------------------mseliiylelselewallradvgltlteaelkrlkglndlleledlski
00468421   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00505371   1/1  eeklmmferLserlskalkkllgklvldeelveelleelelaLleaDVnlkvvkdlienvkekalgeevl
00439861   1/1  -------------------------------------------------------------------kle
00480241   1/1  lfeglskrlssalkkllglllldekdleelleelelaLleaDVgvevvkeliesvkekllgeevldglsp
00459701   1/1  ----------------------------------------------------------------------
00366071   1/1  ----------------------------------------------------------------------
00404191   1/1  --------------------------------------------------------vellpkvtlddlvg
00430591   1/1  ----LskrlssalkkllgllllsekvieelleeleeaLleaDvgvevvkklieevkekalgeevlkglkp
00387941   1/1  ----------------------------------------------------------------------
00394231   1/1  ----LsktlssllkkllgllllsekldeelleelelaLleaDvgvevvkklienlkekalgeevlkglkp
00509891   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00424711   1/1  -------------------------hskkaldelelvldnadvilevvdardpllsldvrlaellegkpr
00484101   1/1  ----------------------------------------------------------------------
00377751   1/1  egLektseslgdalkklllkgklde....elleeleeaLleaDvgvevtleiieelkekalgeev....k
00474061   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00432671   1/1  -------------------------ldeelleelelaLleaDvgvevvkelieelkekalge........
00387321   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00467111   1/1  -----------------------------------------------------------lgepiqlided
00374071   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00437921   1/1  -------------------------------------------------------lglllveklrpklld
00410321   1/1  ----------------------------------------------------------------------
00471271   1/1  ------------------------------------------------------------------prai
00516041   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00394721   1/1  ------------------------------------------------lvslleslelplleklrpvlld
00480501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------Likkllkdllilllklgellleallellleellllallllellellek
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00381511   1/1  ------------------------------lllillelllalarllleellldllkldlilpeesfeelg
00508671   1/1  ----------------------------------------------------------------------
00503561   1/1  -------------kPydrLldivgigfltaddialalgiagdsperlllalallsellgeghlylplddl
00392701   1/1  -------------------------------------------------------------eklrpvlld
00437941   1/1  ----------------------------------------------------lrplveklrpknlddvyg
00419031   1/1  -------------------------aaplggdleelleeleeaLleaDvgveateelledlrekvreelk
00381411   1/1  ----------lllgelvllklklkellrelleillelealrkplesfedlglpelllealkklgfe.ltp
00437901   1/1  --------------------------------------------------------slllvekyrpvlld
00378621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00494911   1/1  -----------------------------------------------------------llveklrpvll
00474201   1/1  -----------------------------------------------------deelelleklslllvek
00482551   1/1  ----------------------------------------------------------------------
00476651   1/1  ---------------------------------------------------------yeplveklrpvll
00499331   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------plveklrpvlld
00468951   1/1  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00503741   1/1  ---------------------------------------------------fifldlrplallplp...d
00520041   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------kkvaivllsnyalsisld
00513251   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00402371   1/1  ---------------------------------------------------vlektgipltkllrpvlld
00401211   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00437981   1/1  --------------------------------------------------lveklrpknldkvi.....g
00487022   2/2  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00487021   1/2  ----ldadpeelleRllkRgres............ergepldlleevlekylarflgeterliaplkkaa
00477721   1/2  ----ldapleelleRllkR.........ggrfdllielplleelkeilrellplykeladlvidtsglsl


                         -         -         *         -         -         -         -:140
query           AEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
00480251   1/1  ------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyrps
00468601   1/1  -------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyraa
00475371   1/1  ----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrps
00490731   1/1  -------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrpa
00448931   1/1  ------------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvg
00373851   1/1  ----------------------------rellllllllllllkgkpkviavtsgkGGvGKTTtaanLaaa
00513761   1/1  ---------------------------kiiai.vGkgGsGKTTllnklaglla.dggkvlvidlDparan
00485931   1/1  ----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadirrig
00430601   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------MplggkpkviavtsgkGGvGKTTtaanlAaalaerGkkVllidaDp.q
00452761   1/1  ----------------------------------------------------------------------
00426921   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00360951   1/1  ----------------------------kviavtsgkGGvGKTTtaanLaaalarlGkkVllidlDpqgp
00371631   1/1  ygplsrlikllleellrllgklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlli
00468421   1/1  -------------------------mmkviav.sgKGGvGKTTtaanlAaalaelGkkVllvDlDpqgpl
00414121   1/1  -------------------------kpgevvllvGpsGaGKTTLlrallgll..eglkvaviepdfgeil
00505371   1/1  dglnpgqllikivkdeLvkllgpe----------------------------------------------
00439861   1/1  everistgipeldellgG.....glpkgslilitGppGsGKTtlalqlaanlaknggkvlyisleesreq
00480241   1/1  gelvikilkeeLvellgp----------------------------------------------------
00459701   1/1  ----------------------------MpkvillvGppGsGKTTlakaLakrlgekgvkvvvidtddlr
00366071   1/1  ----------------------------------------------------------------------
00404191   1/1  leelkealkealell......slgikpgeivllyGppGtGKTtlakalanelkkrggrvlyvsadelvsk
00430591   1/1  gellikivveeLvellggeke-------------------------------------------------
00387941   1/1  --------------------------mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgps
00394231   1/1  gellikivleeLvellgp----------------------------------------------------
00509891   1/1  ---------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpgrld
00485451   1/1  ---------------------------skiygdealkdvsleikkllnlsgkpgeiigivGpsGsGKsTl
00410531   1/1  ---------------gelknlslelkkglkillvGlngvGKTtllkrlag....................
00469131   1/1  -------------------------mmkviavtsgkgGvGKTtlaanlaaalaerGkrVllvdlDlpqps
00478081   1/1  ----------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrr
00478131   1/1  ----------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddlr
00477011   1/1  -------------------------------eelrklldlidklrdlllsldlglpkvaivGrsgsGKST
00424711   1/1  llvlnKaDlldaealalllealslglgnvafksalgglglealldlllellkellellrlslllkkglkv
00484101   1/1  -----------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldig
00377751   1/1  dgeelieilkeeLvellgpve-------------------------------------------------
00474061   1/1  -------------------------mmkviavtsgkGGvGKTtvaanlAaalaelGkrVlliDlDpqgps
00477561   1/1  -------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrra
00470731   1/1  --arpltfddvvgqdeakeeleellag...llgikkpkvillvGppGsGKTTlaralakel...gagfil
00432671   1/1  ...llkilkeeLvellgpeakplllkkkptvill------------------------------------
00387321   1/1  ------------glkglllrlklelkkllkillvGlpgvGKTtllnrllg....................
00434401   1/1  ----------------------lsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrp
00512891   1/1  ----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdvrsar
00366991   1/1  ----------------esllkklelkkllkillvGlpgvGKTtllnrll.....................
00457311   1/1  -------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddlyk
00467111   1/1  g..glldlldelleilsei.....dqpvlvvaivGrpnvGKStLlNaLl.....................
00374071   1/1  ----------------------lkkkrirniaivGhvdaGKtTLlnaLlgtlgaiseaglvkllkeagel
00462761   1/1  -----------------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepg
00437921   1/1  dvvgqeealerlllalk.........agklphlllvGppGvGKTtlaralarlllgsgggvdvielda..
00410321   1/1  -----------yggllllkdlslelkkglkilllGlngaGKTTllnrll.....................
00471271   1/1  lelesliksllekllellkrlslklk.kglkva.lvGrpgvGKStLlnallg..................
00516041   1/1  -----------------------mlk.gklillvGppGsGKtTlaralaeel...glpfvvidaddl...
00451571   1/1  ------------------------MsikkgeiiaivGppGsGKsTlaklLakll.....glivldgddll
00483811   1/1  ---------------------------PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellrg
00348321   1/1  --------------------ilealrsgrvvllvgptGsGKTtlalalalel...ggrvlvlvptralae
00472911   1/1  ----------------------mkmkkgklilltGppGsGKtTlaraLaell....gapfisgddllrgl
00394721   1/1  dvvgreealeallealrr.........gpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpvvr
00480501   1/1  ---------------------------MgklillvGppGsGKtTlaralaell...g.gvvvidgddlrr
00527961   1/1  lllflllllpelleellkllgfelrpyQleaieallegrdvllagptGsGKTlvalllilel....gkrv
00478391   1/1  ----------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllrel
00487061   1/1  -------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvd
00381511   1/1  ...ldpellealkk.gffeltpiQkeaipailkgrdlllvapTGsGKTlaallpalelllkgkrvlvlaP
00508671   1/1  -----------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepg
00503561   1/1  veellklleldelllelieleellkelleeilvellkedlelvlderrlyleeleldelglaellkelle
00392701   1/1  dvvgqeeakeallealagarlaledlslgirpgknvlLvGppGvGKTtlaralagll...gapfgrvdas
00437941   1/1  qeevlkalslale.............kgrpehlllvGppGtGKTtlakalaglllptsggvrvlgidase
00419031   1/1  ----------------------------------------------------------------------
00381411   1/1  iQkeaipailk................gedvllvapTGsGKTlaallpaleallkgkrvlvlaptrelae
00437901   1/1  dvvgqeeakeallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakel...gapvi
00378621   1/1  ------------glklllrrlslllkkglkvllvGlpgvGKstllnrla.....................
00489391   1/1  ----------------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllrea
00499191   1/1  ---------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvdgllvgvvfq
00494911   1/1  ddlvgqeeakealleala.......agrpghvllvGppGtGKTtlaralanellrlgvlglpfvrvnase
00474201   1/1  lrpvllddlvgqeeakeallealr.......agrpghvllvGppGtGKTtlaralanelprslpglpfvr
00482551   1/1  ---everlstgipalDellgG.....glppgslvliaGppGsGKTtlalqlaanaalplelgklggkvly
00476651   1/1  ddlvgqeeakealleala......ggrpprpvllvGppGtGKTtlaralanelgrpfvpvallcfvrvnc
00499331   1/1  ----------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddllr
00510561   1/1  ------------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLD
00406781   1/1  dvigqeeakeallealaglrlllkdlslgippgknvllvGppGtGKTtlakalagel...gvpfvrisas
00468951   1/1  ---lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDlllgiG.....glprGel
00477722   2/2  ----------------------------kpklilltGppGsGKttlaraLaeel....glpfidtddllr
00432181   1/1  ---------------------slelkkglkvalvGrpgvGKStLlnallg....................
00372481   1/1  -------------------dlslllkrirnvaivGhvdaGKsTLlnaLlgalgaiveagevklalvldsl
00517841   1/1  ----hgegirdlldlidelrdllerldldlpkiavvGrpnvGKSsLlnall......grdflpvssgpgT
00533151   1/1  ---------------------MsldikkgklivltGppGsGKtTlarlLaerl....glpfistddllre
00503741   1/1  rlvgrdeeiealskalgg.....aldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfg
00520041   1/1  --------------------iipallsgrdvvllaaptGsGKTlaallpilelllegggrvlvlaPtral
00462581   1/1  ------edleslllnplvkfedivpkvlddleealealaea.klp......ppkg.vllyGppGtGKTtl
00482661   1/1  dlllildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlell
00513251   1/1  ------------iellsdlsls..ipspevvllvGppGsGKstlakklaell.....gfilidaddlr..
00362391   1/1  -------------------------krirnvaivGhvdvGKtTLlnaLlgllgaiv.gdvallalvldsl
00402371   1/1  dviGqeealeallealrr.......rpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrld
00401211   1/1  -----------------------elkrglnvgivGhvgaGKSTLlnaLl..............gllldtl
00379551   1/1  ------karlqkrkavldarlaaaleerglvlvftgnGkGkttaalglalralghglrvlvvqflkggwd
00498531   1/1  ------------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLD
00496061   1/1  ----------------------------gklivltGppGsGKtTlaklLaerl....glpvistddllre
00437981   1/1  qeealkdlslalk.............pgeiphalllvGppGsGKttlaralagllgpdsgkilldgkdi.
00487022   2/2  -----------------------------rmkiivltGpsGsGKsTlarlLaell....gvvvidtddll
00469361   1/1  -------------------------MkkripkiaivGhpnvGKsTLlnrl.................lga
00444821   1/1  -----------------------elkkllkvllvGlpgvGKttlln........................
00487021   1/2  dvividasgsleevveeil---------------------------------------------------
00477721   1/2  eelv.elileale---------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIRRRVEERARLEVRDLVLVDTAGRLQIDERLMEELVRLKAALR
00480251   1/1  apeqlgilgellgvpvvgvltgldlagalrealellllegydvvliDtagglqrglllalaladlllvll
00468601   1/1  aaerlgigavpqdvplfpsltvldnlalardlleaakaagydvvlidtaglld.ldrlvgelsggqkqrv
00475371   1/1  arellgllgellgldvlvgarggdlsgglrqrlarallgdpdvlliDepgrgldpellallaelldllre
00490731   1/1  adellgvlaeelgldvllgarggdlsgglrqrlarallgdydvliiDtpgtldvllelallellkellae
00448931   1/1  adiarlaareqlgivfqdpgltvlenlalgeleararellellgledydvvliDtagrlrlpselsggqk
00373851   1/1  laerGkkVllvdaDp.qaslsdllglegerlpvtvidvlrgledledlivepgldllpagllaeleella
00513761   1/1  lpeqlgidirdlidletvmelglgpngalvfaleellttldillealell.eedydyiliDtpGgle.lr
00485931   1/1  avpqlpvlfprltvlenlalggadlaeraeellellglegfdvvliDtagrgrrvgelsggqkqrvaiar
00430601   1/1  ----------------------------------------------------------------------
00373841   1/1  aslsdllgleaedlpvpvrglldllageidledailptlvegldllpaglllaglelllelgrgpggdel
00452761   1/1  ----------------------------------------------------------------------
00426921   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00360951   1/1  ltdlllgleaeevvptladvlggeldlddvivevlegldllpaggllaglelllrgvdeaaallelldal
00371631   1/1  gtDifylpa.eqlkrigllfqkglpealdveellellldlkegledilvpvlsggqkqrlalaralvedp
00468421   1/1  tdlllgleaeptlvdllageidledliledvlltglegldllpaggllpglaellrgpdeaealkellea
00414121   1/1  idgqlledlgvlavrlgigyvpqtlglfpaltvlellalalllredpdlilidsgGqkq.rlalaralla
00505371   1/1  ----------------------------------------------------------------------
00439861   1/1  lleraerlgldleellllgllsiliadplglsgeellrvllalalelkpdlliiDeltalldaer.vrel
00480241   1/1  ----------------------------------------------------------------------
00459701   1/1  reaikqliglglfdedgegalrrreavakllldallkalkagggdvvilDgtaltleqreallellkelg
00366071   1/1  ----------------------------------------------------------------------
00404191   1/1  lsggl.....................qeqrvaiafalarkpdllllDEidalgldpelqeellelldela
00430591   1/1  ----------------------------------------------------------------------
00387941   1/1  lslllglegeplgladllageadledailetpegldllpaglllagl.ellrgerlrelleel..addyD
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ldeplgvdrerlrrvgelalllaggglcalvaddlagaleellaralaggpdviliEgagllplpliell
00485451   1/1  lrlLagllkpllltggkvlvigldifrlsarelrkrigvfqdpallphltvpenldlgllleilervlel
00410531   1/1  ...................gefvdygptigvnfktvevdgvklviwDtaGqerfrsllarylrg......
00469131   1/1  lslllglepeelgladlllglvdledvllktsspgldllpaggplaglelllsealrelleel..rddyD
00478081   1/1  eairelllgldlleilf...eglllsdefrelleealalladgdvvilDgfgrlldarqlleelllllle
00478131   1/1  reavgqlglglsieeldealllpdalrralleealealkag..dvvildgfgrslaarqlllellrelgr
00477011   1/1  Llnall......Gldvlpvgggpgtrrptelrlsetpgltvlvvflelgerldllglvfqdfsllpelie
00424711   1/1  alvGlpnvGKSTLlnaLl.............................gak..vaivsdipgtTrdivlgv
00484101   1/1  rldldellgigylfqdvgllpvltvrenlalllrglpgysaeeleralellelagfdvilie..Gllela
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  lslllglepeppgladllageadlddailptvvegldllpaglplagvellgperlrelleel.rgdyDy
00477561   1/1  lifqdeldlfdedreegfrvpe.elvrellkellarllaeggdvvilDgtnltleqrealrr--------
00470731   1/1  idgddlrekavgeleklgr....dlfqvaregglvpdilfideidallrkgpd.vildgag.rtpeqlea
00432671   1/1  ----------------------------------------------------------------------
00387321   1/1  ...................defveygptiginfvtvdlkgvklqlwDtaGqerfrslwllyyrg......
00434401   1/1  aaelllreglgidfqlpdaldrellreevlellglgevvivdvydlsggerqr.aralasgpdvlilDgp
00512891   1/1  rgigyvfqtveellgllaelvglevrg....eleellktlikelsggekqrvalarallakpdvlllDEi
00366991   1/1  ..................ggefeeyvptiginfvtveikgvklqlwDtaGqerfrslwllylr......g
00457311   1/1  lsreelrklrrrigmvfqdpalflnpgltvrenlaeplrllklgkkllepvglpevldryphelsgGqrQ
00467111   1/1  ........gekvgfaivsgvpgtTrdiwmwivvlieldg....rpllliDTpGlgdtekedekelvkial
00374071   1/1  gkgslllaavldsleeerergitidiaavsfetdg...................rkitliDtPGhvdfik
00462761   1/1  sgvvlldgddlr.........lglliglvfqdp..dllpfltvlenvllpllaaglivivdgtlllvglr
00437921   1/1  .....................sdlrgvddlreligevlqalglllggkpdvlllDEidrl..dpdaqnal
00410321   1/1  ................ggefp..eygptiginvgtveldgvklqlwDtaGqerfrsllllylrg......
00471271   1/1  ...............gdfaevg.ptpgtTrdikvvtv.egkgvkltliDtpGlgdpaslqeefralvlry
00516041   1/1  ....lrgeelgriielfdearelvpelallfideidell..akgkvvildgtgrlleldealellg....
00451571   1/1  reaiglvtqdgelllelide.gilvpdeiviellrealeeldadgvildgfprllgqaelllsggkadlv
00483811   1/1  llgqpklydlleellellldege.....kipveliiellkdvlvsdpdviilDelpgtnlklqdletlss
00348321   1/1  qlaerlakllglrvgllvgylirfestrilvvtyglllrll..dlllsdfdliiiDEahelsaetdlllg
00472911   1/1  ageggkplgllfedaleagfrqrladlirallakg.....kvvildgtglsreareellellkelg....
00394721   1/1  ldlsellsvsdlvgel...................egglrglltealalakpsvlflDEidrlldardse
00480501   1/1  alvggl........idgllilfledeaalselvlevllealegggnpdvvildgtnlleedrellrellk
00527961   1/1  lvlaPt.raLaeqwaeel.kflglklvglltgglslkedivitTpgrlldlld..lllknldlviiDEaH
00478391   1/1  vgeggrlgrd......lfdedrllfrellideidlllakgkvvildgtnlsealdealrrllr.......
00487061   1/1  ywaavgggdllrlirelllrlgfgepdafdnellgellealleggkivlsarraqlleirlirpllaegk
00381511   1/1  trelaeqiaeelrkllgflgldlelkvallhgglslkereealedlgeadilvaTpgrlldllrdlknld
00508671   1/1  sgvvlldgddlr.............aglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgle
00503561   1/1  eleideklldkilddle..............................-----------------------
00392701   1/1  d...................llgkyvgelsgglrqr.larallakpsvlllDEidklapkrsptsgldve
00437941   1/1  lld....................pselsggerqrvliaralladpkvlllDEidal..dpeaqnaLlkll
00419031   1/1  ----------------------------------------------------------------------
00381411   1/1  qiaeelrkllgelggdlklkvallhgglslkereealerfgeadilvaTpgrlldgldrlknldlviiDE
00437901   1/1  eidaselrd...............vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEidal.
00378621   1/1  ........geef..........dtpgttiginfgtveldgvklqlwDtpGqerfrsl......tlrylen
00489391   1/1  vpggtdlgel........fqdlllegellfideiaelllealaeaegkvvildgtg...ldieqrealre
00499191   1/1  ddfylllpalevlengaflldlllpdaldrelllelllalveglvvlldryprllsggqrqrvaiadpdv
00494911   1/1  llealllsdlfgell.........gallralfellrgalelakggvlflDEidrl..spdvqnaLlrlle
00474201   1/1  vnasdltd.vglleellgkllgaat...................fllakpgvlflDEidkl..dpdvqna
00482551   1/1  istee..afsperlreralslgldleelldrllvidatdlldllellerlrrllsegkvdlvviD-----
00476651   1/1  aallelsasdll.................eselfgeekeaflgallerlgklalagggtvlflDEidkl.
00499331   1/1  epvig....agtdigevfqdlllaggllvddevrrlllealdelllaggkvvildgfpggllqrealrrl
00510561   1/1  lllgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql..rarrlgld..ldrl
00406781   1/1  e...................llgkyvgelsgglrqrlalara.adpgvlllDEidalldarsgsgsggds
00468951   1/1  vlivGppGsGKTtlalqlaanlaklggkvlyidteesldqlr..arrlgldlddll..llpaltveella
00477722   2/2  elvgegielilelfd..................rarfrkllielldellaaggvvldlgrtlllrralre
00432181   1/1  ................lkvaivsdypgttrdptlgvveldgrklvliDtpGleefasggekqrvalalal
00372481   1/1  eeerergitidsgavsletdg...................rkinliDtPGh....edfske..vlrglav
00517841   1/1  trptelrlgespellaeflidggekltdldelrkeieeatdallgpgkgfsfdtieleielpdlp...nl
00533151   1/1  lvpggldigevfqdaleaglllfddefrglllerleellarg.pvvildgfpggllqrealrrll.....
00503741   1/1  kvvyvnv.selldlkellrlllealglpppyq...lsggerlrvalaeallalgkpdllilDEitnlldp
00520041   1/1  aeqvaeelrgltggervrllerllsgeadilvgtpgrlldlllrdlllrnldlviiDEahrl..dlgfgp
00462581   1/1  aralakel..............................glpfvrinasdllvgllvgelegrlrglftea
00482661   1/1  ekiieellrirldklledldeiveelppvlfddlvgqeeakeallenlklflkgp---------------
00513251   1/1  ........................gqkqrvalleaalke.gylvvvDet...gldraqrlellelardlg
00362391   1/1  keerergiTidigavtletdg...................rlitliDtPGhvd......fvkevlrglrv
00402371   1/1  aselle.................fgkyvgafegglrqllglaraa.kpgvlflDEidsllgargg-----
00401211   1/1  kgelergitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGh....edflke..llr
00379551   1/1  tgelaalkrl..gvdvvvlgegftwdtedreldlaaarealelakelladgeydlvvlDeltlaldlgll
00498531   1/1  allgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql..rarrlgldldelll
00496061   1/1  evepggtdlgeifqalllagellfddevlgllrerldelielllaggvvildgf......pldlegalll
00437981   1/1  .....rrgiglvfqliglfphltvlelvalglggilveevrellkellsgGqkqrvaiaralagdpkvll
00487022   2/2  ra.....gevfqdyalfphltvlelldnvllgleirgllkaerlervevllervgllldrippalsgGqg
00469361   1/1  kfaigyigtvgndpgttrldsleeerergitidsglvkfelng............lnliDtPGhed....
00444821   1/1  .....rllggefai..........ygptiginfgtveldgvklqlwDtaG..qerfrsl....wllylrg
00487021   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
00480251   1/1  ldepllvldatagtellelakgllealgldgvvltkldlvaalgaalsvalilglpilflgtgenvddle
00468601   1/1  aiaralaapevllldeptsgldalaellelleelgltvlvvtKlDgtakgghdlslalrladrilvlgvG
00475371   1/1  lradlgllvvdathdldavlkaadrilvldlggivlnkldlvakggaalelaeelgvpllsiplgegidd
00490731   1/1  lgadvvllvvdatlgleaadrilvlleglgvpgvvlNkldlvaeggaalelleelgvpilsaltgegvdd
00448931   1/1  qrvaiaralaaplppevllldeptsgldalrellellrelgltvlvvthlDllakggadlslaleladri
00373851   1/1  srgadeaallrellellkagdyDvviiDtppglgtlrllelpdvlglyvkglmgelkkitgvltllalaa
00513761   1/1  allalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDllseeglelvl
00485931   1/1  allllldpelllldEptsgldalrlllellkelgltvlvvthddgtakggaalslaleladrilvlgdGe
00430601   1/1  ----------------------------------------------------------------------
00373841   1/1  lalaalrelleaallagdyDvviiDtppglgvltllalaaalgrvvkgllalalaleileileelmeele
00452761   1/1  ----------------------------------------------------------------------
00426921   1/1  ----------------------------------------------------------------------
00386711   1/1  ----------------------------------------------------------------------
00360951   1/1  ..eedyDyvliDtppglgdlglltlaalla.....adgvliVttpealslqdalrllelleklkdnpglp
00371631   1/1  dvlilDgptalldpltrellellkelrd..lldltilvdadlevlleRr---------------------
00468421   1/1  l.agdyDyvliDtppglhdlglltlaalla.....adlvlivttpealslqdakrllkllaklrknpglp
00414121   1/1  dpdlgellllDeptlvlDaasgedlldllkelaeqlgltvlivlnKiDllselthdlellreladrilvl
00505371   1/1  ----------------------------------------------------------------------
00439861   1/1  rellralkrlakelgvtvilvsqltelildalagggaleql........adgvillkrdetakggrrili
00480241   1/1  ----------------------------------------------------------------------
00459701   1/1  lpdlvvfldtpleelleRllkrlkrplpgrldrrieeiledlkgrleiyekpteplleyydkiiklidid
00366071   1/1  ----------------------------------------------------------------------
00404191   1/1  ergvtlilttnnrpeeldqallrllsrldrvivldlppdleergeilkrlaeklglp............l
00430591   1/1  ----------------------------------------------------------------------
00387941   1/1  vviiDtppglgdltllala........aadgvllVvdp..ellalraarrllellrklglpllgvvlNkv
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  rdlldlvvlvvldgivllvdaidrleaadllvlnkldlveia----------------------------
00485451   1/1  lelvgldvvlldtyphelSgGqrqRvaiaralal.........dp.dvlllDEptsglDp........et
00410531   1/1  adgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllrevsaelalelakelgik
00469131   1/1  yviiDtppglgdltllalaaa........dlvllvttpellslrdalrllellrklglpvlgvvlNrvdp
00478081   1/1  epppdlvifldadpevlleRl.lkRgrrerkddseevlellekrleryepllel..--------------
00478131   1/1  vvkpdlvifldappevlleRllkRgrgseddieeelleallrilepylr---------------------
00477011   1/1  lenralagpiagisrdairleielpglp...dltlvDtPGlgsvavvdqlsggqkqrv------------
00424711   1/1  l......gkk.lvliDtPGllefaseleglgkklverflryleeadlvllVvdasdglseq........g
00484101   1/1  lplilelrelsdgqiqrva---------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  viiDtppglgtltllalaaa........dlvllvttpellslrdalrllelleklglpvlgvvlNrvdpr
00477561   1/1  ----------------------------------------------------------------------
00470731   1/1  lldllee...lgrpvvviilttnrevlldralrRpgrllldep---------------------------
00432671   1/1  ----------------------------------------------------------------------
00387321   1/1  adgillVvdatdgdsfeevaklleeilelaglenvpiilvg-----------------------------
00434401   1/1  tlgldvlld-------------------------------------------------------------
00512891   1/1  dgl..dpdvleallelleelkrsgvt--------------------------------------------
00366991   1/1  adgillVvdatdgdsfeevakwleellnlagladvpillvgn----------------------------
00457311   1/1  Rv.ralaldpdllilDeptsalgqpdpelr----------------------------------------
00467111   1/1  lallladvvllvvdggiteqdlellklllelgkplilvlnKwDl--------------------------
00374071   1/1  evirglsv......adgallvvdavegefeaglsvepq--------------------------------
00462761   1/1  ealrkll.......gllsgGqkqrvadlvvlldadpevll------------------------------
00437921   1/1  lklleel.--------------------------------------------------------------
00410321   1/1  adgvllVvdatdgdsfeevkellleilelaglagvpiilvgNKiDllealgarevseela----------
00471271   1/1  lrlrgadavllVvdatdpglfeqdlellkellelfgelagvpiilvlNKiDlldaeeveleeeiaellal
00516041   1/1  ...pdlv---------------------------------------------------------------
00451571   1/1  ifldaplevlleRllkrddekilkrleeqkqrvaiaral-------------------------------
00483811   1/1  vaktlnfpd-------------------------------------------------------------
00348321   1/1  lllellelrp------------------------------------------------------------
00472911   1/1  pvlvifl---------------------------------------------------------------
00394721   1/1  sslevlna--------------------------------------------------------------
00480501   1/1  rl..grp---------------------------------------------------------------
00527961   1/1  rlln..s---------------------------------------------------------------
00478391   1/1  pdlvifl---------------------------------------------------------------
00487061   1/1  vvilDre---------------------------------------------------------------
00381511   1/1  lvilDEahrll.deqrgpllell-----------------------------------------------
00508671   1/1  lrdelrellkeaglpllvvfldaplevlleRdrrg-----------------------------------
00503561   1/1  ----------------------------------------------------------------------
00392701   1/1  lrrrvlna--------------------------------------------------------------
00437941   1/1  eelpk.gv--------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00381411   1/1  ahrll.dsqrgpllellllgfls-----------------------------------------------
00437901   1/1  .dpdvlna--------------------------------------------------------------
00378621   1/1  advvllvvdasdpdsfeellelleellellllagvpiilvlN----------------------------
00489391   1/1  lllelprpdl------------------------------------------------------------
00499191   1/1  lildg-----------------------------------------------------------------
00494911   1/1  e.lpsnvr--------------------------------------------------------------
00474201   1/1  Llrlle.e--------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476651   1/1  .dpdvqna--------------------------------------------------------------
00499331   1/1  l......---------------------------------------------------------------
00510561   1/1  llldaltveell----------------------------------------------------------
00406781   1/1  ssrrvlnaLlrlleelr....................................................l
00468951   1/1  laerllsggkpql---------------------------------------------------------
00477722   2/2  llreldlvvf------------------------------------------------------------
00432181   1/1  lreadvlllvvdadeptsfldle.llellrelllagkp--------------------------------
00372481   1/1  adgallVvdaadgvsp------------------------------------------------------
00517841   1/1  tlvDtPGlgsaavgdqpeeleeafraltleylreadtl--------------------------------
00533151   1/1  .lrpdlv---------------------------------------------------------------
00503741   1/1  etlspdvlelLlrlleegkltd................................................
00520041   1/1  llrlllellp------------------------------------------------------------
00462581   1/1  vlanpgvl--------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00513251   1/1  rpvlvifla-------------------------------------------------------------
00362391   1/1  adgailVvdavegvmpqtrehlllarllgvpkiivviN--------------------------------
00402371   1/1  ----------------------------------------------------------------------
00401211   1/1  alaladgallvvdadegeflpqtlevlllllelgvkpi--------------------------------
00379551   1/1  dleevlelLkarpetlhvvltgr-----------------------------------------------
00498531   1/1  l..paltveell----------------------------------------------------------
00496061   1/1  realarallp------------------------------------------------------------
00437981   1/1  lDEptal.--------------------------------------------------------------
00487022   2/2  qrvildr---------------------------------------------------------------
00469361   1/1  ..frsltlrylrgadgallVvdatdgvsfqtl.ellel--------------------------------
00444821   1/1  adavllVvdatdgdsfeelkellleilellllagvpiilvgN----------------------------
00487021   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PFYPDRLAGRILGMGDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGR
00480251   1/1  vfnpgelvdrllglg-------------------------------------------------------
00468601   1/1  eivedgtpfellel--------------------------------------------------------
00475371   1/1  lldfllellvsrllg-------------------------------------------------------
00490731   1/1  llefipellverll--------------------------------------------------------
00448931   1/1  lvlgdGeivedgtp--------------------------------------------------------
00373851   1/1  adevllvttpetlslqdalrlle-----------------------------------------------
00513761   1/1  elleellellpilllgvgpkdldlilai------------------------------------------
00485931   1/1  ivedgtpeellel---------------------------------------------------------
00430601   1/1  --------------GDvlsLvekaeevideeeaeelleklleskgkfdledfleqlqqlkkmGplskllg
00373841   1/1  kivellkdpeldlvvlvttpeqlaleeakrll--------------------------------------
00452761   1/1  --------------------------------------kfdledfleqleqlkkmGplskllgmlPglgk
00426921   1/1  --------------------------------------kfdledfleqleqlkkmGplskllgmlPglgk
00386711   1/1  --------------------------------------kfdledfleqleqlkkmGplskllgmlPglgk
00360951   1/1  vlgvvlNkvdlrteggvleelaeelglpvlgvipld----------------------------------
00371631   1/1  ----------------------------------------------------------------------
00468421   1/1  vlgvvlNrvdprrekgaleelaeelglpvlgviprdeavreaalagkpvveldpdskaae.....ayrel
00414121   1/1  gdgrivldgppvlllsaftgegl-----------------------------------------------
00505371   1/1  ----------------------------------------------------------------------
00439861   1/1  ivknrggptgevplvf------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00459701   1/1  nltidevvneildllesrilgyl-----------------------------------------------
00366071   1/1  ---------------------------------------fdledfleqlq....................
00404191   1/1  sdevlellaert...gngrelinllera------------------------------------------
00430591   1/1  ----------------------------------------------------------------------
00387941   1/1  dprareelleel----------------------------------------------------------
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00485451   1/1  ralelldllrtdld...................kelgrtiilvthdlreae..adrilvlrkgdivelge
00410531   1/1  fietSAktgeg-----------------------------------------------------------
00469131   1/1  rtellaleelaellglpvlg.vipldpalaeal-------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00424711   1/1  kp.vi-----------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00432671   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00471271   1/1  l---------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00406781   1/1  lsgvtviattndleeldpallrpgrf.drvielplpdleerleilkllleklgl----------------
00468951   1/1  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00503741   1/1  .kllgltliltthdldllerl.adrllsrfngkgivielpplseeelleilk------------------
00520041   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
00480251   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00430601   1/1  mlPglggllellsdlqleldekklkrleaiidsmtpkErenpellnasrkrriakGsGtsvqevnellkq
00373841   1/1  ----------------------------------------------------------------------
00452761   1/1  l....leldekklkrleaiidsmtleErenpellnasrkrriakGsGtsvqevnellkqfeqmkkmmkkl
00426921   1/1  lllslaaleldekklkrleaiidsmtlkErenpellklllknasRkrriakGsGtsvqevnellkqfe--
00386711   1/1  llseleleldekklkrleaiidsmtlkErenpellnasrkrriakGsGtsvqevnellkqfeqmkkmmkk
00360951   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00468421   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00505371   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00366071   1/1  ............lkrleaiidsmtleerenpellnpsrrrriakGsGtsveevnellkqfkqmkkmmkkl
00404191   1/1  ----------------------------------------------------------------------
00430591   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00485451   1/1  p---------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00432671   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           ERRKGRGLMGMFRR--------------------------------------------------------
00480251   1/1  ----------------------------------------------------------------------
00468601   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00373851   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00485931   1/1  ----------------------------------------------------------------------
00430601   1/1  f---------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00452761   1/1  gk--------------------------------------------------------------------
00426921   1/1  ----------------------------------------------------------------------
00386711   1/1  l---------------------------------------------------------------------
00360951   1/1  ----------------------------------------------------------------------
00371631   1/1  ----------------------------------------------------------------------
00468421   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00505371   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00480241   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00366071   1/1  ----------------------------------------------------------------------
00404191   1/1  ----------------------------------------------------------------------
00430591   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------
00394231   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00410531   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00478081   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00424711   1/1  ----------------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00377751   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00432671   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00366991   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00467111   1/1  ----------------------------------------------------------------------
00374071   1/1  ----------------------------------------------------------------------
00462761   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00527961   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00381511   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00419031   1/1  ----------------------------------------------------------------------
00381411   1/1  ----------------------------------------------------------------------
00437901   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00489391   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00494911   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00482551   1/1  ----------------------------------------------------------------------
00476651   1/1  ----------------------------------------------------------------------
00499331   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00406781   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00477722   2/2  ----------------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00372481   1/1  ----------------------------------------------------------------------
00517841   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00462581   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00513251   1/1  ----------------------------------------------------------------------
00362391   1/1  ----------------------------------------------------------------------
00402371   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00379551   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00487022   2/2  ----------------------------------------------------------------------
00469361   1/1  ----------------------------------------------------------------------
00444821   1/1  ----------------------------------------------------------------------
00487021   1/2  ----------------------------------------------------------------------
00477721   1/2  ----------------------------------------------------------------------