[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81035.1


[Show Plain Result]

## Summary of Sequence Search
   1::433
  17::203  2.8e-22 32.6% 0044160 00441601 1/1   crotonase                               
   7::198  2.1e-21 26.1% 0049617 00496171 1/1   crotonase                               
   9::198  7.1e-21 28.7% 0051228 00512281 1/1   crotonase                               
  20::198  9.8e-20 29.3% 0052142 00521421 1/1   crotonase                               
  15::199  6.3e-17 24.3% 0052604 00526041 1/1   crotonase                               
   1::433


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGHTFSLRAYRIRAVKRLWALILLLPIALGKTYLVPIEGEIDPALAVFVEQALARAEREGASGVAFLIDT
00441601   1/1  ----------------krlerlldiysrllkvaviflsgpivdgladdvvaallaaeaddpvkgivlyin
00496171   1/1  ------llvplvvlllllllllldiysrllkvriiflggpiddetaelviaqllllesddsikaivlyin
00512281   1/1  --------llivvllllllllivdiysrllkvlviflsgpivdgsaedvvaallaaesddsikaivlyin
00521421   1/1  -------------------lllldlysrllkvaviflggpivdgsaelivaallaaeaddsvkgivlyin
00526041   1/1  --------------qtsrgerlldiysrllkeriiflggeIddetanliiaqllllesedpkdillyinS


                         -         -         *         -         -         -         -:140
query           PGGRVDAAIRISDRILQTPLPTLAVVQNAFSAGALIALSCRQIVMLPGSEIGAALPVVALPLQEPQAADQ
00441601   1/1  spGGsvtaglaiydalrrlkkpvvaivlglaasagyllalaadkgkivalpnarvgihgpiggalg...s
00496171   1/1  SpGGsvtaglaIydalrrlkkpvvtivlglaaSagyliaaagdkgkryalpnarvgihgplggasgqaed
00512281   1/1  spGGsvtaglaIydalralkkpvvaivlglaaSagylialaadkgkiyalpnarvgihgpeggargdlsa
00521421   1/1  spGgsvtaglaiydalralkkpvvayvlglaasagyylalaadkgkiyalpnarvgihgplggalgsaed
00526041   1/1  pGGsvtaglaiydtlksikapvvtivlglAaSaaslillagdkgkrfalpnarimihqpsggalgqasdi


                         +         -         -         -         -         *         -:210
query           KVISALKGKFRAVAEARGRPVELAEAMVDPNLEVPGLSAKGEPLTLSADKAVELKVADLKAASLYEALQA
00441601   1/1  aedieilaelldklyelfvelvaegrglslekleeladrd............twlsaeeAlel-------
00496171   1/1  ieilaelllklrerfieivaerrglsleeiekladr............dtwltaeeAl------------
00512281   1/1  edreilaalldklyerfielvaegrglslekveelad............rgrvltaee------------
00521421   1/1  leilaelldklyerflelvaegrglslekiekladr............dtwltaeeAl------------
00526041   1/1  eilaeellklkerlveiyaektglslekieklmdr............dtwltaeeAley-----------


                         -         -         -         +         -         -         -:280
query           AGFSPEVERLAPGPRVQVARFLTSSTVAGLLLALGLLLLLVELFTPGFGVAGALGLAFLALYFAGGWLAG
00441601   1/1  ----------------------------------------------------------------------
00496171   1/1  ----------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00521421   1/1  ----------------------------------------------------------------------
00526041   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LSGAFELLLFLLGVALLLAEAFLFPGFGIAGVLGVGSILASVYFTFGENALLVLSVAVIALGLGLVLVFR
00441601   1/1  ----------------------------------------------------------------------
00496171   1/1  ----------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00521421   1/1  ----------------------------------------------------------------------
00526041   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           YLPRTRPAQALVLESAIQGHATEEAVEVGAVGTALTDLRPGGVARFGAKRVDVVANRGFIPKGTPVRVVE
00441601   1/1  ----------------------------------------------------------------------
00496171   1/1  ----------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00521421   1/1  ----------------------------------------------------------------------
00526041   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VRGITVVVEPLEE---------------------------------------------------------
00441601   1/1  ----------------------------------------------------------------------
00496171   1/1  ----------------------------------------------------------------------
00512281   1/1  ----------------------------------------------------------------------
00521421   1/1  ----------------------------------------------------------------------
00526041   1/1  ----------------------------------------------------------------------