[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81141.1


[Show Plain Result]

## Summary of Sequence Search
   1::244
   1::235  9.9e-80 44.9% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   2::238  3.8e-79 41.5% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   1::229  8.3e-79 42.8% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   7::220  8.5e-79 42.5% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   1::238    3e-78 41.0% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
   4::240  4.7e-77 41.6% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   4::230  8.3e-77 42.0% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   2::239  1.8e-76 42.2% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   1::224  2.4e-76 43.6% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   2::240  3.3e-76 46.4% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   2::242  1.4e-75 41.0% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   5::224  3.8e-75 44.2% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   3::243  8.2e-75 41.0% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   5::239    9e-75 42.4% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   2::241  3.4e-74 40.1% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   3::243  5.6e-74 40.8% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   3::241  7.4e-74 39.2% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   2::241  1.6e-73 39.6% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   4::230  8.7e-73 42.6% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   2::230  9.3e-73 42.3% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   1::240  7.7e-72 39.7% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   6::237  3.6e-71 42.4% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   4::225  1.8e-70 40.5% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   1::240  3.5e-69 40.2% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   8::224  7.7e-69 41.5% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
  12::238    1e-68 47.4% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   3::212  9.1e-68 44.7% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   2::241  4.1e-66 45.8% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::231  9.6e-66 41.2% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   3::246  2.5e-65 44.4% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   1::242  3.3e-65 41.8% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   2::225  8.7e-65 41.2% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
   1::237    9e-65 42.5% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::239  3.5e-64 38.5% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   4::207  7.2e-64 41.6% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
   2::237  2.5e-62 41.5% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
  28::241  3.8e-60 46.2% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   1::240  4.2e-60 35.5% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   7::240  5.1e-60 42.9% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
   2::230  4.9e-58 43.9% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
  17::239  6.3e-58 43.6% 0053253 00532531 1/1   arboxykinase-like                       
   1::230  7.9e-58 43.5% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  20::235  1.8e-56 45.1% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
  22::230  8.5e-56 40.6% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
  25::234  3.9e-55 42.2% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   5::227  7.2e-54 36.8% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
  17::196  7.3e-52 51.0% 0047552 00475521 1/1   arboxykinase-like                       
  30::184  8.1e-51 44.7% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  15::203  1.2e-50 41.8% 0047841 00478411 1/1   arboxykinase-like                       
  28::244  3.9e-49 39.2% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   2::239  7.4e-49 34.9% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
   3::220  4.8e-48 42.9% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
   1::240  1.7e-47 34.9% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
  13::225  1.9e-44 37.2% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
  29::191  4.8e-44 43.5% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
   7::196  1.4e-43 41.4% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  29::188  1.5e-42 43.4% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
  27::232  8.8e-42 39.3% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  28::217  5.4e-41 37.3% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  27::244    3e-40 36.8% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
   5::233  3.8e-40 31.6% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
  15::198  4.1e-40 36.1% 0047844 00478441 1/1   arboxykinase-like                       
  28::216  5.3e-40 40.1% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  19::218  8.1e-40 34.6% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   1::231  1.1e-39 37.7% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  24::170  3.9e-39 46.2% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
   5::240    8e-39 27.7% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  31::224  2.2e-38 35.8% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
  29::241  5.9e-38 34.8% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  29::239  3.1e-37 36.7% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
  29::212  1.6e-36 43.5% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   6::243  2.9e-36 34.8% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  23::192  6.3e-36 44.4% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   1::128  3.1e-35 37.2% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
  24::218  5.2e-35 33.3% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
  29::232  1.6e-33 32.7% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  24::235  2.8e-33 29.4% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
  24::218  5.5e-33 30.6% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
   7::218  2.7e-32 33.9% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  29::186    3e-32 40.0% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   4::232  3.5e-31 33.2% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  24::212  5.7e-31 39.5% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  25::196  7.8e-30 38.3% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  10::212  8.8e-30 34.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  22::230  1.3e-29 25.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   8::196  1.4e-27 31.6% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
   2::242  3.2e-27 24.7% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  10::232  8.6e-27 31.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  28::220  8.1e-26 31.3% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  14::243  1.8e-25 31.9% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  31::234  4.5e-25 25.8% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  29::212  5.1e-25 43.0% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  29::240  6.1e-25 30.4% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
  14::233  1.5e-24 28.7% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  30::222  3.7e-24 32.3% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
  27::225  9.5e-24 28.8% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  29::217    3e-23 29.6% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
   1::213  9.3e-23 33.3% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  17::246  1.6e-22 28.9% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
   8::228  3.4e-22 27.6% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  22::245  5.3e-21 22.4% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  31::220  5.8e-21 22.5% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  24::194  1.6e-20 40.7% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  25::237  1.7e-20 27.6% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  21::230  5.1e-19 34.3% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  17::233  1.8e-18 30.3% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  12::208  2.4e-18 24.6% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
   1::234  7.5e-18 24.4% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  29::189  9.8e-18 30.3% 0037884 00378841 1/1   p containing nucleoside triphosphate hy 
  31::212    2e-17 30.7% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  30::170  5.7e-17 39.5% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  24::233  9.3e-17 24.9% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   8::212  9.4e-17 27.3% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  10::199  2.6e-15 25.4% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  29::224    5e-15 28.3% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  28::167  8.1e-15 30.8% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
   3::199  4.5e-14 28.1% 0047394 00473941 1/1   p containing nucleoside triphosphate hy 
  27::218    5e-14 23.6% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  26::231  1.1e-13 23.4% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  29::244  1.6e-13 31.9% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  30::228  8.5e-13 28.7% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  29::234    1e-12 22.0% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
  23::212  1.1e-12 30.9% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
   3::226  4.6e-12 19.6% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  18::228  1.4e-11 20.3% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  29::173  1.4e-11 25.4% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  23::194  2.6e-11 30.8% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  30::243  3.2e-11 23.3% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  26::212    1e-10 27.4% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
  29::187  1.4e-10 23.6% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
  30::214  1.4e-10 29.4% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  20::236  1.8e-10 23.2% 0043012 00430121 1/1   p containing nucleoside triphosphate hy 
   7::213  3.7e-10 24.0% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  18::86   3.8e-10 32.4% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  25::219  5.5e-10 20.1% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  23::184    1e-09 35.2% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
  29::190  3.2e-09 26.7% 0040315 00403151 1/1   p containing nucleoside triphosphate hy 
  19::195  8.1e-09 25.2% 0041830 00418301 1/1   p containing nucleoside triphosphate hy 
  29::196  1.2e-08 29.8% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  14::190  7.1e-08 25.2% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
   9::93   1.4e-07 31.0% 0044125 00441251 1/1   p containing nucleoside triphosphate hy 
  31::214  1.7e-07 24.8% 0046315 00463151 1/1   p containing nucleoside triphosphate hy 
  29::243    2e-07 21.1% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  30::109  6.7e-07 30.7% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   3::50   6.9e-07 33.3% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  26::216  9.9e-07 25.9% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  26::65   1.3e-06 32.5% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  29::184  1.6e-06 23.2% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  30::165  1.9e-06 22.9% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
   6::190    6e-06 21.6% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
   8::198  1.9e-05 19.2% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
  30::197  2.1e-05 23.9% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
  15::50   2.2e-05 33.3% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  29::100  5.1e-05 25.4% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
  29::65   5.3e-05 41.2% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
  30::207  6.6e-05 22.4% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
  31::212  7.4e-05 19.3% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
  31::212  8.5e-05 22.5% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
  28::110  9.7e-05 27.8% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
  32::206  0.00011 25.9% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
   7::183  0.00012 21.5% 0049757 00497571 1/1   p containing nucleoside triphosphate hy 
  26::69   0.00013 36.4% 0035786 00357861 1/1   p containing nucleoside triphosphate hy 
  29::50    0.0002 40.9% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
  21::65   0.00025 26.7% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  29::164  0.00031 20.8% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
  16::60   0.00038 26.2% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
  30::61   0.00038 23.3% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
  15::50    0.0004 30.6% 0038732 00387321 1/1   p containing nucleoside triphosphate hy 
  29::69   0.00086 39.0% 0044740 00447401 1/1   p containing nucleoside triphosphate hy 
  31::50   0.00087 55.0% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
  28::58   0.00095 37.0% 0049582 00495821 1/1   p containing nucleoside triphosphate hy 
   1::244


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKD
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00378981   1/1  -lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldlll
00379581   1/1  lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldita
00390411   1/1  ------MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlir
00509431   1/1  M...lelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllraggls
00500441   1/1  ---lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldg
00475891   1/1  ---lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldg
00420701   1/1  -lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldl
00422801   1/1  llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllklla
00361211   1/1  -plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvll
00482201   1/1  -llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilg
00367901   1/1  ----lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidl
00482261   1/1  --lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdild
00425571   1/1  ----lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldlla
00490801   1/1  -llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeivalvG
00502741   1/1  --lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilg
00458601   1/1  --lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditg
00510251   1/1  -lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeival
00530591   1/1  ---llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagl
00475991   1/1  -lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsG
00495371   1/1  esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evlvd
00404101   1/1  -----elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldlta
00466971   1/1  ---llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00500611   1/1  pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsgeil
00466931   1/1  -------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdil
00485451   1/1  -----------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltg
00436071   1/1  --pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla
00372301   1/1  -yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggi
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00469451   1/1  --allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgk
00379601   1/1  ledllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel.
00424961   1/1  -lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglldp
00488521   1/1  lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGei.
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00436511   1/1  ---ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltik
00422141   1/1  -dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifld
00457311   1/1  ---------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddl
00495031   1/1  lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplggk
00496111   1/1  ------elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliigle
00367481   1/1  -yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllpa
00532531   1/1  ----------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinl
00437981   1/1  lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldgkd
00448931   1/1  -------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiar
00468601   1/1  ---------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyr
00485931   1/1  ------------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi..
00503371   1/1  ----Mmlksle..lknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdl
00475521   1/1  ----------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlv
00381441   1/1  -----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlpr
00478411   1/1  --------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvr
00414121   1/1  ---------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeil
00368501   1/1  -kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlara
00464791   1/1  --lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkG
00371631   1/1  mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrllgk
00462761   1/1  ------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddl
00515531   1/1  ----------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtiei
00356411   1/1  ------lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidg
00515511   1/1  ----------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtiei
00464411   1/1  --------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsg
00477971   1/1  ---------------------------hkgelvvlvGPsGaGKsTLlnaLlgllp.tsgvisvsgttr..
00487021   1/1  --------------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidtddll
00379961   1/1  ----yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnls
00478441   1/1  --------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd....d
00426051   1/1  ---------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvd
00475371   1/1  ------------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDi..
00437941   1/1  lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvrvlg
00480471   1/1  -----------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilge
00379261   1/1  ----drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvlLvGppGvGKTtla
00512891   1/1  ------------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv..
00533501   1/1  ----------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepig
00496571   1/1  ----------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepir
00475381   1/1  ----------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrla
00489571   1/1  -----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.............
00508671   1/1  ----------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgs
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00468951   1/1  -----------------------lnvlgesidalgkilseilkllekgfltalgllerksverlstgika
00493431   1/1  ----------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttrep
00498531   1/1  -----------------------ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDa
00510561   1/1  -----------------------ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDl
00503741   1/1  ------fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtL
00484101   1/1  ----------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldig.
00368571   1/1  ---llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlgelgrhllivGptGsGKStll
00511381   1/1  -----------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilv..kdai
00451571   1/1  ------------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl..
00434401   1/1  ---------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfy
00490731   1/1  ---------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDp.y
00477011   1/1  -------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrpte
00470731   1/1  -arpltfddvvgqdeakeeleel..lag.llgikkpkvillvGppGsGKTTlaralakel..gagfilid
00444381   1/1  ---------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrspairrlle
00498811   1/1  ---------------------------kPgkiigltGpsGsGKsTlarlLael.....gvividgddlt.
00392701   1/1  -------------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvdasd.....
00513761   1/1  ------------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDpar
00499191   1/1  ----------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd........
00532471   1/1  ----------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdv
00406781   1/1  -------------aglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisase.....
00405881   1/1  -----------------------------gervglvGrpgaGKSTLlnaltglkaivsgypgttldpnlg
00439861   1/1  --------------------------kleeveristgipeldellgGglpkgslilitGppGsGKTtlal
00489631   1/1  ----------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddll
00404191   1/1  vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlakalanelkkrggrvlyv
00513251   1/1  ----------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr.
00437921   1/1  -------lglllveklrpkllddvvgqeealerlllalkagklphlllvGppGvGKTtlaralarlllgs
00480251   1/1  ---------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpy
00480441   1/1  ------------------------------rlivllGpsGaGKsTlaklLaellp...glivisvgdttr
00432181   1/1  -----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptl
00499331   1/1  ------------------------PslslkkgklivltGppGsGKtTlakaLaerl....glpfidtddl
00420941   1/1  --------------------lglslgirpgkgvllyGppGtGKTtlakalagel..gapfiridg.....
00386741   1/1  ----------------lealkavllgirpgehllLvGppGtGKTtlaralagelga..............
00527261   1/1  -----------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalakelgkpv
00437901   1/1  keallealalararplkrpelflslgirpgrillLyGppGvGKTtlakalakelgapv..ieidaselrd
00378841   1/1  ----------------------------kelkillvGdsgvGKstLlnrllgdefiveyiptigvdvytk
00469161   1/1  ------------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfg
00515351   1/1  -----------------------------mngklivltGppGsGKtTlaraLaerl....glpvistddl
00533151   1/1  -----------------------MsldikkgklivltGppGsGKtTlarlLaerl....glpfist....
00367291   1/1  -------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralanel.
00394721   1/1  ---------lddvvgreealeallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv
00402371   1/1  ----------------------------pgrnvllvGppGvGKTtlaralagllvrssgpilldgvpf..
00461621   1/1  ---------------------------mkgmiialtGppGsGKsTlaklLaerl.....glpfistddly
00473941   1/1  --eklrpvllddvvgqeevkkalllalalallrgepgehvlLvGppGtGKTtlaralagllga.......
00482551   1/1  --------------------------everlstgipalDellgGglppgslvliaGppGsGKTtlalqla
00472911   1/1  -------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrgla
00487061   1/1  ----------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviye
00482721   1/1  -----------------------------kgkiigltGpsGsGKsTlarlLael.....glpvidtddly
00457851   1/1  ----------------------------PkgklivltGppGsGKtTlakaLaerl....glpvistddll
00521551   1/1  ----------------------lslglrpgkgvlLvGppGtGKTtlaralagllga..............
00416171   1/1  --diigqeeakka.....llealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalt
00410531   1/1  -----------------gelknlslelkkglkillvGlngvGKTtllkrlag..................
00476071   1/1  ----------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll
00517691   1/1  ----------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg.....
00496061   1/1  -----------------------------gklivltGppGsGKtTlaklLaerlglpv..istddllre.
00478391   1/1  -------------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddll
00516041   1/1  ----------------------------mlkgklillvGppGsGKtTlaralaeelglpfvvidaddl..
00478081   1/1  -----------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvidt...d
00430121   1/1  -------------------rkglelgirpggnvllvGPpGvGKTtlakalagllfpsgvp..firinlse
00482661   1/1  ------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdiayqyallakedenaaaflk
00495771   1/1  -----------------galldilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrh
00489391   1/1  ------------------------lsikkgklivltGppGsGKtTlakaLaerl....glpvistddllr
00409841   1/1  ----------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpil
00403151   1/1  ----------------------------kglkivlvGdsgvGKTtLlnrllgdefpvsyiptigvdfyvk
00418301   1/1  ------------------llealalplkrlelfeklrgirpgknvlLvGppGtGKTtlaralakllgr..
00519581   1/1  ----------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaellf
00410321   1/1  -------------yggllllkdlslelkkglkilllGlngaGKTTllnrll...................
00441251   1/1  --------qgvefigflealknilkgipkknclllyGPpgtGKstlakalagllggtvlsvnnsnlnfwl
00463151   1/1  ------------------------------MkiIgltGpiGsGKsTvaklLaekl...........glpv
00477561   1/1  ----------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddl
00478131   1/1  -----------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidg...
00471271   1/1  --prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStL--------------------
00401211   1/1  -------------------------elkrglnvgivGhvgaGKSTLlnaLlgll................
00420081   1/1  -------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvg-----
00457881   1/1  ----------------------------mgklivltGppGsGKtTlaklLaerl....glpvidtddllr
00493171   1/1  -----------------------------mgklivllGpsGaGKsTlaklLaeklglivlsv........
00470231   1/1  -----elaellsllierlllrdlllelkll.kvllvGdpnvGKStLlnrlkivsdpgtTigvvgtveldg
00474201   1/1  -------deelelleklslllveklrpvllddlvgqeeakeallealragrpghvllvGppGtGKTtlar
00477721   1/1  -----------------------------kpklilltGppGsGKttlaraLaeel.....glpfid....
00378621   1/1  --------------glklllrrlslllkkglkvllvGlpgvGKstllnrl--------------------
00493981   1/1  ----------------------------kpklilltGppGsGKttlaraLaeel.....glpf...idad
00512061   1/1  ----------------------------kkkkgklivltGppGsGKtTlakaLaerl..g.glvv-----
00480501   1/1  -----------------------------MgklillvGppGsGKtTlaralaell..g.gvvvidgddlr
00515801   1/1  ------------------------------llIvltGppGsGKtTlaklLaerl....glpfistddllr
00486921   1/1  ------------------------------mlivltGppGsGKtTlakaLaerl....glpfistddllr
00479331   1/1  ---------------------------ap..kliltGppGsGKttlakaLaeel.....glpfidt....
00509891   1/1  -------------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdp
00497571   1/1  ------aselvqwlldlgildeseilledlenalalllsligaklvkdllllvlkylpsllslldvlrpk
00357861   1/1  -------------------------kkdklfkillvGdsgvGKTtLlnrllgdeflveyiptigidfyt-
00491901   1/1  ----------------------------lmkgkiilltGppGsGKttlak--------------------
00414001   1/1  --------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypftT-----
00486891   1/1  ----------------------------m..livltGppGsGKtTlakaLaerl....glpvidtddllr
00488191   1/1  ---------------fllsllrrlslllkrllkvalvGlpgvGKStLlnallgakflakv----------
00523461   1/1  -----------------------------a.kvalvGlpnvGKStLlnallgdk.aivsdi---------
00387321   1/1  --------------glkglllrlklelkkllkillvGlpgvGKTtllnrl--------------------
00447401   1/1  ----------------------------kelkivlvGdsgvGKttLlnrllgnkfivsyiptitvdilt-
00518511   1/1  ------------------------------klIvleGpsGsGKsTlaklL--------------------
00495821   1/1  ---------------------------akelkvlllGlsnvGKttllnrl....kfve------------


                         -         -         *         -         -         -         -:140
query           DRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPREKAEKKALELLERVGILDQARKYPAQLS
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00378981   1/1  lslaelllllrrgigyvfqdpalfpgltvrenlalgllla.glskaeaaaraaellellglddlldrlvg
00379581   1/1  lslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskaearervlellelvgl
00390411   1/1  rgadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrr
00509431   1/1  dliflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdi.slldlrelrrli
00500441   1/1  kdildlsl...lrrgigyvfqdpalfpgltvlenlllgll.llglslaeaaeralelllllgledlldrl
00475891   1/1  kdilglsllellrrgigyvfqdpalfpgltvlenlllgll.llglalkeaalralllllllgletlldrl
00420701   1/1  lllslaellalrrgigyvfqdpalfpgltvrenlalglllag.lskaeararalellellglddlldrlv
00422801   1/1  gllkptsGeilldgldilalslae.lrrrigyvfqdpalfp.ltvrenlalglllallllglskaearar
00361211   1/1  dgleisalslaerlragigyvfqdlalfpeltvlenlalg..............rarellerlglail.d
00482201   1/1  ls..lkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalralllllllgletlldrlp
00367901   1/1  ilkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdi.slldlrelrrligyvpqdpal
00482261   1/1  ls..laelrgigyvfqqdallpsltvlenlllgllllgellllllaakeaalralllllllgletlldrl
00425571   1/1  lsl...lrrrigyvfqdpalfpgltvrenlalgllll.glskaeaaaralellellglddlldrlvgeLS
00490801   1/1  pnGsGKSTLlkllagllkptsGeilidgkdi.tglspqelrrlgglvlqdvllffltll...........
00502741   1/1  ls..laelrgigyvfqqlallpsltvlenlalgll.llglskaeaaaraaellellgledlldrlpseLS
00458601   1/1  ..lspqelrrlggvvvqevllffltllenlllglallllllvlllllllllllllaakeaalrallllll
00510251   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkdi.tglspqelrrlgglvlqdvllffltll.........
00530591   1/1  lkptsGeilldgkditdls..lkelrgigyvvqqdallpsltvlenlllgllllgllllllaakeaalra
00475991   1/1  eilldgkdildlslael..rgigyvfqqdallpsltvlenlllglllagellllllaakeaalralllll
00495371   1/1  gldltglspa...rggiglvfqteallppltvrenlealgldlrglld...rerviellelvgleelldr
00404101   1/1  lslael.rrgigyvfqdpalfpgltvrenlalgll......kaeararalellellgldelldrlvgeLS
00466971   1/1  dilglslaelllllrrgigyvfqdpalfpgltvlenlllgllllglllllaakeaalrlellllllglet
00500611   1/1  lggkvlyisleeslrrrrigmvfqelgldpdltv..................arerviellelvgllell
00466931   1/1  alspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallldl
00485451   1/1  gkvlvigldifrlsa.relrkrig.vfqdpallphltvpenldlglll.......eilervlellelvgl
00436071   1/1  ......lrrgigyvfqdpalfpgltvlenlalgllllgll...ealaralellellglgdl.drlvseLS
00372301   1/1  lvdgedlr...........igyvfq...................................llervgledl
00498251   1/1  Lalrllagllkpgggvvyidgeesldll....rarrlgvvlqelllfpeltveenl..............
00469451   1/1  dvlylsleesleqlrrrigyvfqdpalfp..........................aeellelvgledlld
00379601   1/1  ......lrnkigyvfQdpvlfp.ltvren.........................................
00424961   1/1  dsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialgaeyf.rdegadvlllads
00488521   1/1  ...............ggkvlyvdqeeslfp.ltvlenlalg............gedveellerlgl.dll
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlr...elrelrrrigyvfqdpalfpeltvlenlal
00436511   1/1  kGervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpa
00422141   1/1  eeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledlg
00457311   1/1  yklsreelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk........llepvglpevldr
00495031   1/1  vlyigleltlsperlrlraqsl...........................gldldellerllvidllelvg
00496111   1/1  .lsaeelrerrrrigyvfqepalfpeltvlenlalgll...........................drlpg
00367481   1/1  sggilvpgedalll..............................................rvdeiltrvg
00532531   1/1  eggfyakaigllrrkigyvfq...lfpfltvlenvalgld...glvdeedleraenllalvgleeipnry
00437981   1/1  i.........rrgiglvfqliglfphltvlelvalgl...ggilveevrellkel...............
00448931   1/1  la....areqlgivfqd....pgltvlenlalg..........eleararellellgledydvvliDtag
00468601   1/1  aaaae..rlgigavpqdvplfpsltvldnlalardlleaa...kaagydvvlidtaglld.ldrlvgels
00485931   1/1  ........rrigavpqlpvlfprltvlenlalg........gadlaeraeellellglegfdvvliDtag
00503371   1/1  liylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliel
00475521   1/1  ...dleplrrdigmvfqdpalfplltvrenvilgllelaglskaealarvdellelvglddellldrlp.
00381441   1/1  lgevdgvdltfls.....reeigyvfqepallpdltvlenlylglllalllaleegkivildgdreraee
00478411   1/1  lglkd....gigmvfqdpalfplltvrengvalglllaglskaeieervdlllelvglddlldrypdels
00414121   1/1  idgqll.edlgvlavrlgigyvpqtlglfpaltvlellalall...........................
00368501   1/1  lakllga..pfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllvseli
00464791   1/1  ervglvGpnGaGKTtLlkllagllkpdsgeivvyg...ligerprevrellglllelgvlf.........
00371631   1/1  lalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpa..eqlkrigllf
00462761   1/1  r.......lglliglvfqdpdllpfltvlenvllpllaagliv......ivdgtlllvglrealrkllgl
00515531   1/1  dgvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenlan
00356411   1/1  vkltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvp
00515511   1/1  dgvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlan
00464411   1/1  eplge....ligevfqdgilfpdltvlenvalgrygllglikealaegvivildrvglsdla..ypgfls
00477971   1/1  .pprpgevdgvgyvfqsrelfpeltvagnf.legaevrgnlygtsrerveellea.gldvlldidpqgls
00487021   1/1  ra..........gevfqdyalfphltvlelldnvllgleir.gllkaerlervevllervgl..lldrip
00379961   1/1  dlldpkdlrellragiplvflnfaalpasllesel...................................
00478441   1/1  lvllelrgrdilmvfqppalfpllevrglniaevlelaglskaealkrvdlvlelvgld...drypyels
00426051   1/1  lggesglllrdlrrliglvfqdpilfpgltvglllffldnidlgllirgdeeleaalelaglprvielll
00475371   1/1  ........................................rrpsarellgllgellgldvlvgarggdls
00437941   1/1  idaselld..............................................................
00480471   1/1  illdgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllgldllllellkelkydp
00379261   1/1  ralAkllgapfvevdaselteg.gyvgedlekrirelfqearllvfltvlenirldaseylekrvvsrli
00512891   1/1  ....rsarrgigyvfq........tveellgllaelvgle.............vrgeleellktlikels
00533501   1/1  tp.....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalaegvsvildrvglsdlay
00496571   1/1  geplgelir...glvfqdpllldeltvlenlalgrylhlglilaalaagvgvvldrvglsdlaygfprtl
00475381   1/1  vlsrdllgllreglirigyvfqdyalfprltvlenvllgll.........................llgg
00489571   1/1  ......................................................................
00508671   1/1  gvvlldgddlraglsiglilsdedraalrrrlgevfqelllagrlvvldgtalgl.elrdelrellkeag
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalf------------
00468951   1/1  LDlllgiGglprGelvlivGppGsGKTtlalqlaanlaklggkvlyid....teesldqlrarrlgldld
00493431   1/1  rpgev...rgigyvfqsgalfphlivagnl.legaevhgllygtskerveeale....kgllvlldrdls
00498531   1/1  llgiGglprGsltliaGppGsGKTtlalqlaanlaklggkvlyisteesleql...rarrlgldldelll
00510561   1/1  llgiGglprGelvliaGppGsGKTtlalqlaanlaaqggkvlyisteesleql...rarrlgldldrlll
00503741   1/1  akllagllkpkfgeillfg.....................................kvvyvnvselldlk
00484101   1/1  rldldellg.igylfqdvgllpvltvrenlal.llrglpgysaeeleralellelagfdvilieGllela
00368571   1/1  rllaglllpdggrviviDpkgeyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgr
00511381   1/1  dtrlgielvvsriglvleavglffaldllelll.....................................
00451571   1/1  ......lreaiglvtqdgelllelid.egilvpdeiviellrealeeldad.gvildgfprllgqaell.
00434401   1/1  rpaaelllreglgidfqlpdal.......................drellreevlellglgevvivdvyd
00490731   1/1  rpaadellgvlaee.........................................lgldvllgarggdls
00477011   1/1  lrlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpiagisrdairleielpglpdl
00470731   1/1  gddlrekavgeleklgrdlfqvaregglvpdilfideidall.rkgpdvildgagrtpeqlealldllee
00444381   1/1  llgarpgenvlLvGppGtGKTtlakalakllgv..pfiridgselte....kelvGe.............
00498811   1/1  relvaggglliglifqdfglfelldrellielllenlalglal.egvildalrrrllelldllgldvvil
00392701   1/1  .........................................................llg...kyvgels
00513761   1/1  anlpeqlgidirdlid......letvme.lglgpngalvfaleellttldillealell..eedydyili
00499191   1/1  .......gllvgvvfqddfylllpalevlengafll.dlllpdaldrelllelllalveglvvlldrypr
00532471   1/1  gelggaalldivde..grliglvfqdldllpllevlellaa........................rleel
00406781   1/1  ............................................................llgkyvgels
00405881   1/1  vveldd.........................grqlvlvDtpGliel...aslgeglvrqalealeradvi
00439861   1/1  qlaanlaknggkvlyisle.esreqlleraerlgldleellllgllsiliad..................
00489631   1/1  rellgellgrgigfgfqqgdlledatvlenlalllldeidka.....................ledggvv
00404191   1/1  sa..................................................................de
00513251   1/1  ......................................................................
00437921   1/1  gggvdvieldasdlrgvddlreligevlqalglllgg.................................
00480251   1/1  rpsapeqlgi.lgellgvp.vvgvltgldlagalrealell....................llegydvvl
00480441   1/1  .epregevlgvdyvfvdrelfeelivagnlled.aivhgllygtskerieealda.glgvlldgfprgls
00432181   1/1  gvveldgrkl....................................................vliDtpGl
00499331   1/1  lrepvig.agtdigevfqdlllaggllvddev..................rrlllealdelllaggkvvi
00420941   1/1  .................................................sellg.........kyvgels
00386741   1/1  ...........................................................pfvrldasels
00527261   1/1  iyidlselsskgyvdleellrelaeelgell.......................ellkkllkklsellgl
00437901   1/1  ..........................................................vddlsgyvgels
00378841   1/1  tveidgkkvklqlwDtaGqerfrsllelyyr.............gadgillvvdvtdresfeelkkwlee
00469161   1/1  tplgelirelllegfqdlilvpdllvlellaanraglrelikellaagkgvildrfplsrlay....qls
00515351   1/1  lreavpg..gtdigelfqdyllfpfltvdeni...........rglllealeellaagkvvild......
00533151   1/1  ddllrelvpggldigevfqda.leaglllfddefrglller...................leellargpv
00367291   1/1  .gapfirvda............................................................
00394721   1/1  .......................................................vrldlsellsvsdlv
00402371   1/1  ............................................vrldaselle.......fgkyvgafe
00461621   1/1  revvergtelgklikdyfdpgalvpd.llirlllerllfldegggflldgfprtleqaeals........
00473941   1/1  .......................................................pfielsasdllg...
00482551   1/1  anaalplelgklggkvlyisteeafsperlreralslgldleelldrllvidat................
00472911   1/1  geggkpl.........................................................gllfed
00487061   1/1  pvdywaavgggdllrlirelllrlg........fgepdafdn.ellgellealleg..............
00482721   1/1  relvaggtplgerirellgegyllpdea.........lfrallaellfgdllalalldgvvydrlrdell
00457851   1/1  re..avpggtrlgeviqdlfllggllffdeldel...lkerieellaag.gvild.........gfpldl
00521551   1/1  ...................................................pfvrlsaselvgkyvgele
00416171   1/1  e.....................................................dlleselfghekgafg
00410531   1/1  .....................................gefv...dygptigvnfktvevdgvklviwDta
00476071   1/1  .ggpllerirellgegyllfdealdrellaallfglelegal.........................ldg
00517691   1/1  ............................................gtlllllgllsfllalvldslplere
00496061   1/1  ..evepggtdlgeifqalllagel.lfddevlgll..rerldelielllagg.vvildgf.........p
00478391   1/1  .relvgeggrlgrdlfdedrllfrellideidl.....................................
00516041   1/1  ...lrgeelgriielfdearelvpelallfideidell...........................akgkv
00478081   1/1  dlrreairelllgldlleilf...........................................egllls
00430121   1/1  ltekllvselig.......................................................hpp
00482661   1/1  snrqkklvrdladrviaeerlellekiieellrirldklledldeiveelppvlfddlvgqeeakealle
00495771   1/1  tTrdvllirle.glvl------------------------------------------------------
00489391   1/1  eavpg..gtdlgelfqdlllegellfideiaelllealae..............................
00409841   1/1  gvvlldgrd.............................................................
00403151   1/1  tveidgkkl..........................vkltlwDtaGqerfrslrelyyrgadgvllvydvt
00418301   1/1  ............................................................pfirvdasel
00519581   1/1  gdvgglvvdli...........................................................
00410321   1/1  ......................ggefpeygptiginvgtveldg...vklqlwDtaGqerfrsllllylr
00441251   1/1  adlidkkvvlldEadstcwdyiv-----------------------------------------------
00463151   1/1  idtgDilrkalyratglgalakiisliellilfgelvpd.dlvldrlvlerlvfsdpee.vildgphplv
00477561   1/1  rr...............................................alifqd.eldlfdedreegfr
00478131   1/1  ..ddlrreavgqlglglsieeldealllpdalrrallee-------------------------------
00471271   1/1  ----------------------------------------------------------------------
00401211   1/1  .............................................................ldtlkgele
00420081   1/1  ----------------------------------------------------------------------
00457881   1/1  elepdg..telgellqdlllaggllpdai.........vrdlllelleelladgkgvild...gfprdle
00493171   1/1  gdttrepregevdgvdyvfvsgelfkelidagelledaivigllyergtlldavegalld.........g
00470231   1/1  vklqlwDtaGqerfrsltlrylrgadavll..VvDasdydlvllepdsferlee.wleelrellanplla
00474201   1/1  alanelprslpglpfvr..vnasdltdvglleellgkllgaat...........................
00477721   1/1  tddllrelvgegielilelfd.........................rarfrkllielldellaaggvvld
00378621   1/1  ----------------------------------------------------------------------
00493981   1/1  dllr.elvgegigllfelaeraeflillid----------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00480501   1/1  ralvggl................................................idgllilfledeaal
00515801   1/1  eavpggtpl..geeirdlldagellpdeelr.......................................
00486921   1/1  eavpggtd..lgelfqelllegellfrdell.......................................
00479331   1/1  ddllrklvgesirellelagelaprillldeilellekgg------------------------------
00509891   1/1  grld.......................................ldeplgvdrerlrrvgelalllagggl
00497571   1/1  vdfddiileeakeelllellelplklpelfkrlglkapkrrgvlLyGppGtGKTllakalakelgrl.pf
00357861   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00486891   1/1  eleidgtplgeeirdlllagellfraevrdll..................................yell
00488191   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVF
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00378981   1/1  eLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrlad
00379581   1/1  dtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakegltvllvthdl
00390411   1/1  giglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllelleg
00509431   1/1  gyvpqdpnllfqltvlenlllgpeerrelldellglellsleealaraeealeelnallkeleeelelig
00500441   1/1  vseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltvllvthdlsealrl
00475891   1/1  vseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelakegltvllvthdldealrla
00420701   1/1  geLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealrla
00422801   1/1  alellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpetraellellrelak
00361211   1/1  rlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellellkelakelgvtvilvt
00482201   1/1  seLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gltvllvthdlsea.rlad
00367901   1/1  fpqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeel
00482261   1/1  pseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak.gltvllvthdlseal.la
00425571   1/1  gGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvthdlsealaladril
00490801   1/1  lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlllLDEPtsgLDpetrael
00502741   1/1  gGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvthdldealrladrilv
00458601   1/1  lgledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllvt
00510251   1/1  ..lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdllllDEPtsgLDpetra
00530591   1/1  lllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak.gl
00475991   1/1  llgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelakegltvllv
00495371   1/1  lprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlakelgvtvllvthdleeve
00404101   1/1  gGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelakegltvllvthdldealr
00466971   1/1  lldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakegltvllvthdlde
00500611   1/1  drlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkrlakelgvtvllvthdl
00466931   1/1  llllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvst
00485451   1/1  dvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrtdldkelgrtiilv
00436071   1/1  gGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvthdldlalaladriv
00372301   1/1  ldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellaelgatvlfvtHdlel
00498251   1/1  ..................drlprllsggqrqrvvidsalalrpkllllDEPtsgldplsarellellrrl
00469451   1/1  rlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkelakelgvtvilvtH.
00379601   1/1  ........laralrqdPdilllDEptsalda....ellqallt....ghtvvlvthhlntaldladriiv
00424961   1/1  llrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlveggsdpdllllDept
00488521   1/1  drlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvsllrellrlLkrlakel
00468691   1/1  gallag.................lglaeyldelgkdLSgGqrqrvalAr.....pvlLllDEptsgldal
00436511   1/1  lpallrllalfpaltvaenlrfglglavlllldsatrlaqakreisalarellervglpgdlftlls---
00422141   1/1  lsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.............i
00457311   1/1  yphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadlgltlirlitrdlg
00495031   1/1  llelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlLkrlakelgvtvilvt
00496111   1/1  eldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrlkelgvtvilvthdle
00367481   1/1  lsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeallellaellgatvlvvt
00532531   1/1  pselsgGqqqrv...........illldEPtsgLdpvsr...........................lela
00437981   1/1  .lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak.gvtvilathdlsellpalls
00448931   1/1  rlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel...gltvlvvthlDl
00468601   1/1  ggqkqrvaiarala.apevllldeptsgldalae..llelleel...gltvlvvtKlDgtakgghdlsla
00485931   1/1  rgrrvgelsggqkqrvaiarallllldpelllldEptsglda..lrlllellkel...gltvlvvthddg
00503371   1/1  lldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekrle
00475521   1/1  ..sggqqqeilrvaiallilpvllgralallpelllldeptsaldpdlveeilell--------------
00381441   1/1  llellgldadlviilpasleellerldrrggelsggqkqRvala--------------------------
00478411   1/1  ggqrqrvaiaralalepelllldeptsaldplavvellelllglnee.ldiilalelllldel-------
00414121   1/1  lredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeqlgltvliv
00368501   1/1  gappgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellka
00464791   1/1  ..................aaellervglvaatadeppgelsggqrqrlaiAraladdqgkpvllllDEpt
00371631   1/1  q.kglpealdveell....................ellldl.kegledilvpvlsggqkqrlalaralve
00462761   1/1  lsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplygadiviithdls.iee
00515531   1/1  vpillvlnKiDlleakeraeellellglgdlldklpselsgGqkqrvalar-------------------
00356411   1/1  i.ilvlNKiDlleekive.ellellgleykgdrdpeelsggqkqrvalaralakdp--------------
00515511   1/1  vpillvl.nKiDlleaklvllllvglfdlldglpselsggqkqrvala----------------------
00464411   1/1  ggeqqrvaiarallpkpdlvllldepteeldeRllkRg....rllekleyikkrlehylelaepykddvv
00477971   1/1  ggqkqrlalaralilppsllrgldep.ealdarle.raleellelae.gfdvvivnhdleealelldril
00487021   1/1  palsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpegilpdlvifldadpe
00379961   1/1  ...lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlll
00478441   1/1  ggerqrvailr..vllpklllpdepgrnldvlievavlnlilkllgidallelvdrle------------
00426051   1/1  e.gldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkrltrpgldadteeellel
00475371   1/1  gglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvdathdldavlkaad
00437941   1/1  pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk.gvtvilttnrleeldpal
00480471   1/1  villlnkidllddrllrraeaeerieelle----------------------------------------
00379261   1/1  gappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslvlllgglglpevgelllelldd
00512891   1/1  ggekqrvalarallakpdvlllDEid.gldpdvleallelleelkrsgvtvilttndldel.eladrial
00533501   1/1  dgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelreldseevlekrlehylell
00496571   1/1  sglgqrqrvalarallkpdlvifldeppteeldeRlrkrl........rlgdteevlehrleraeeladr
00475381   1/1  lvvildggvrqrlalarallldpdvllldeplllldaalr............................dl
00489571   1/1  ..lallelrntteagaasgsrdkgllgklkpetraelldllre...egttilvvth.ldeaer.aDrvav
00508671   1/1  lpll.vvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlv------------------
00387201   1/1  ----------------------------------------------------------------------
00468951   1/1  dllllpaltveellala................................erllsggkpqlvviDsltalr
00493431   1/1  ggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgplieydyvivnddleeal
00498531   1/1  lpaltveellala................................erllsggkpdlvviDsltalapsll
00510561   1/1  ldaltv................................eellalaerllsggkvdlvviDsltalapale
00503741   1/1  ellrlllealglp.....ppyqlsggerlrvalaeallalgkpdllilDEitnlldpetlspdvlelLlr
00484101   1/1  lplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdla------------------------
00368571   1/1  geddfftpaarallralilalaeepe.ptldellellselg........lrdladrleklvagglaglle
00511381   1/1  ................qdpdviliDE.aqfldp....evvevlleladtgilvlvtglemdfagelfegs
00451571   1/1  .lsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpail--------------
00434401   1/1  lsggerqr...aralasgpdvlilDgptlgldv............lldlpdlvifvdhdlevalerrlkr
00490731   1/1  gglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvvdatlgleaadril
00477011   1/1  tlvDtPGlgsvavvdqlsggqkqrvalarallknpdtlillvedand..ldtesda--------------
00470731   1/1  ......lgrpvvviilttnrevlldral.rRpgrllldep..eldppdreerleilkrllkklgtvldvt
00444381   1/1  .........................................segailsggfkqrvgia..lladpgilfl
00498811   1/1  egplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelaplygaadividnd.lsl
00392701   1/1  gglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrlleglrllsgvtviattn
00513761   1/1  DtpGglelrallalllaiaralaadeillvddptsgldaetqleilelllelllklgipiilvlnKlDll
00499191   1/1  llsggqrqrvaia.....dpdvlildgptllldpe............................lrpladl
00532471   1/1  lerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdlleslllvlplpdlviyl
00406781   1/1  gglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrlleelrllsgvtviattn
00405881   1/1  llvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDeptneldlellellee.......lg
00439861   1/1  .................plglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrla
00489631   1/1  lldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarleeryradlviv
00404191   1/1  lvsklsgglqeqrvaiafalarkpdllllDEidalgldpelqeellelldelaergvtlilttnnrpeel
00513251   1/1  .gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpvlviflatspevlierlldrvll
00437921   1/1  ............................kpdvlllDEi.drldpdaqnallklleel.pagvtlilttnr
00480251   1/1  iDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvltkldlvaalga
00480441   1/1  qaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgladvvivnddleeal
00432181   1/1  eefa.......sggekqrvalalallreadvlllvvdadeptsfldle....ll----------------
00499331   1/1  ldgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrleryeeltrdli
00420941   1/1  gglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrlldglqalsnvtviattn
00386741   1/1  ggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivgggllteldglllpsgvlvia
00527261   1/1  silglelilglsggdleelleelaellkklgkpvililDEiqslldvsske.lleaLlrlldegknvt--
00437901   1/1  ggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvliilttndpeeldpa
00378841   1/1  ilrlle.agvpiilvgnKiDllgrqvlveearalakelgiplf..etSa---------------------
00469161   1/1  ggerqrlaidlegalllerllldep......................................fpdlvif
00515351   1/1  .glsggllqrvallrallrpdlvifldapl----------------------------------------
00533151   1/1  vildgfpggllqrealrrlllrpdlvifldapleelleRllkrgrlirleddseevlekrlerylklyer
00367291   1/1  ...........selleklvgegegrlrgalaealradpgvlflDEidalagkrgsgtsrldpevqnaLlr
00394721   1/1  gelegglrglltealala.kpsvlflDEidrlldardsesslevlnaLlrlledgnvlv-----------
00402371   1/1  gglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleeg...nvrviaatnrpelvk
00461621   1/1  .....kpavlsggrkqrlalaralavd-------------------------------------------
00473941   1/1  ..esdlrggfkqa........akpgvlflDEidrl.drevqnaLlelleelqvtilggg-----------
00482551   1/1  .............dlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellr
00472911   1/1  aleagfrqrladlirallakgkvvild..gtglsreareellellkelg..pvlvifldadpevlleRll
00487061   1/1  ......gki.vlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllggldleevkaleell
00482721   1/1  aelsggqgdvliiegalllepgllplpdlvifldap..pevl.leRllkRggdseeeiekrleryreiap
00457851   1/1  egaealreallragplpdlvifldapleelleRllkrgreplddteevilkrlerlrelyerliepyeea
00521551   1/1  gglrqllalaraa..npgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegledlsnvlviaatn
00416171   1/1  ggekqrlgllrla..dggvlflDEidkl.dpdvqnaLlrvleegeltrlgggivlpadvrliaatnpdll
00410531   1/1  GqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgnKlDlldalllrev
00476071   1/1  lvygvlqdrllerllaagpdvlildgpl.lldv-------------------------------------
00517691   1/1  rgitidvalarllldgrkilllDtPGhedfvkevlralrladgallvvdadegv----------------
00496061   1/1  ldlegalllrealarallpdl.vifldapleelleRllkr..............................
00478391   1/1  .............llakgkvvildgtnlsealdealrrllr..........................pdl
00516041   1/1  vildgtgrlleldealellgpdlvifldappeelleRllkrgldeea-----------------------
00478081   1/1  defrelleealalladgdvvilDgfgrlldarqlleelllllleepppdlvifldadpevlleRllkRgr
00430121   1/1  gyvGedelgvlfeaarkappsvlllDEidkl.dpd....vlnaLlqlleegevtdlggrvvdlsnvivia
00482661   1/1  nlklflkgpellldl..glpkgrgllLyGPpGtGKTtlakalanel...ggpvi................
00495771   1/1  ----------------------------------------------------------------------
00489391   1/1  ..............aegkvvildgtg..ldieqrealrelllel.prpdlvifldadpeelleRllkrgl
00409841   1/1  ..............................llllDtPGlidfas--------------------------
00403151   1/1  dresfenvl.swleelrellgllllegvpillvgnKlDlptnerdvslee--------------------
00418301   1/1  te........aelvGyesgarlrelfaragigllaladpgvlflDEidkllparg---------------
00519581   1/1  ............dleaverhlldiaeellengeilildeptvgldsk...dildel--------------
00410321   1/1  gadgvllVvdatdgdsfeevkellleilelaglagvpiilvgNKiDllea--------------------
00441251   1/1  ----------------------------------------------------------------------
00463151   1/1  qaeild.....eiaralsvvldllvldeplvglqrrl.agrrgivadgrdigtvvfpdaelvkllleasl
00477561   1/1  vpeelvrellkel.larllaeggdvvilDgt..nltleqrealrrllkel..grpdlviyldapdeelle
00478131   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00401211   1/1  rgitikigaasllldklaivsdtpgttldpilgvleldgpkllllDtPGhe...dflke...llralala
00420081   1/1  ----------------------------------------------------------------------
00457881   1/1  qaealrallaelglppdlvifldaplevlleRllkrgddpeeal--------------------------
00493171   1/1  fpv.lldgalqlllllrelllkpdl---------------------------------------------
00470231   1/1  nvpiilvgNKiDl...leelakelglapv.fetSaktge.vdelfealae--------------------
00474201   1/1  ...................................fllakpgvlflDE.idkldpdvq------------
00477721   1/1  lgrtlllrralrellreldlvvfldapleelleRllkRggrfdllielplleelkei-------------
00378621   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00480501   1/1  selvlevllealegggnpdvvildgt..nlleedrellrellkrlgrpdlvifldapleellerllk---
00515801   1/1  ...dlllevirellaag.gvildgf..pldleqaealrallke.................lglrpdlvif
00486921   1/1  ..................................dlllevieellaag.gvildgfplslegaqalrall
00479331   1/1  ----------------------------------------------------------------------
00509891   1/1  calvaddlagaleel.laralaggpdviliEgagllplpliellrdlldlvvlvvldgivllvdai----
00497571   1/1  irvn.......................................---------------------------
00357861   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00486891   1/1  lealeaggvvldgfpldleqaell----------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MDGGQIVEEGRPEEIFTRPKEERTRSFLQRVLHH------------------------------------
00440861   1/1  pglvvlisaltgegldeltvrenla---------------------------------------------
00378981   1/1  rilvlddGrivelgtpeellenpaslyt------------------------------------------
00379581   1/1  dealrladrilvlddGriv---------------------------------------------------
00390411   1/1  lkeeaekaka------------------------------------------------------------
00509431   1/1  plldglellvglnglldrplselSgGek------------------------------------------
00500441   1/1  adrilvlddGrivelgtpeellenpkslyt----------------------------------------
00475891   1/1  drilvlddGrivelgtpeel--------------------------------------------------
00420701   1/1  drilvlddGrivelgtpeellenpaslyt-----------------------------------------
00422801   1/1  .gltvllvthdlsl--------------------------------------------------------
00361211   1/1  hdldlldsallrpgkrpllsdlrgsgeieq----------------------------------------
00482201   1/1  rilvlddGrivelgtpeellenpgllytllll--------------------------------------
00367901   1/1  lellglgglldrpv--------------------------------------------------------
00482261   1/1  drilvlddGrivelgtpeellenpgllytllll-------------------------------------
00425571   1/1  vlddGrivelgtpeellenpaslytaell-----------------------------------------
00490801   1/1  lellrelakegktvllvtHdlseal.ladri---------------------------------------
00502741   1/1  lddGrivelgtpeellenpgllytllllgslpg-------------------------------------
00458601   1/1  HdldealrladrilvlddGriveegtpeell---------------------------------------
00510251   1/1  ellellrelakegktvllvtHdlseal.lad---------------------------------------
00530591   1/1  tvllvtHdlseal.ladril--------------------------------------------------
00475991   1/1  tHdlsealrladrilvlddG--------------------------------------------------
00495371   1/1  eladrvavlaggriveqgadvvlflrrdeg----------------------------------------
00404101   1/1  ladrilvlddGrivelgtpeellenpl-------------------------------------------
00466971   1/1  alrladrilvlddGr-------------------------------------------------------
00500611   1/1  reveeladkrdrvvvlrggriveqgadvvl----------------------------------------
00466931   1/1  LSGGerqrvalara--------------------------------------------------------
00485451   1/1  thdlreae..adrilvlrkgdivelgep------------------------------------------
00436071   1/1  vl--------------------------------------------------------------------
00372301   1/1  aalladrvvvlndgrivavgtpeelyklpag---------------------------------------
00498251   1/1  lrlakelgvtvllvthdldea-------------------------------------------------
00469451   1/1  .......Asdrvlvlrdgrivevgtpdelllkplll----------------------------------
00379601   1/1  lddGriveegtpeellanplasaldlvvaqrl--------------------------------------
00424961   1/1  salDgeivlslllal-------------------------------------------------------
00488521   1/1  gvtvllvthdldevarladrvlvlagg-------------------------------------------
00468691   1/1  r..eilellrellkelgytvllvthdls.-----------------------------------------
00436511   1/1  ----------------------------------------------------------------------
00422141   1/1  eyvfqspnlfpl...............-------------------------------------------
00457311   1/1  eagrsadrvl....griveqgppeelfinpq---------------------------------------
00495031   1/1  hdlrevegrleladrvvvlrggrileqgad----------------------------------------
00496111   1/1  eaedladsgriavladgrivlegdlaelgl----------------------------------------
00367481   1/1  Hdlelaalaadrivvln.gr--------------------------------------------------
00532531   1/1  driyvllsGrivesgtteelltepkatfs-----------------------------------------
00437981   1/1  rcqvirfpplseeelleild--------------------------------------------------
00448931   1/1  lakggadlslaleladrilvlgdGe---------------------------------------------
00468601   1/1  lrladrilvlgvGeivedgt--------------------------------------------------
00485931   1/1  takggaalslaleladrilvlgdG----------------------------------------------
00503371   1/1  llekeleeleellerle-----------------------------------------------------
00475521   1/1  ----------------------------------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00478411   1/1  ----------------------------------------------------------------------
00414121   1/1  lnKiDllselthdlellreladrilvlgdgrivl------------------------------------
00368501   1/1  lkeaeaeellellglkdlllrkpsqlSgG-----------------------------------------
00464791   1/1  sgldal..re------------------------------------------------------------
00371631   1/1  dpdvlilDgptalldpltr.ellellkelr----------------------------------------
00462761   1/1  vadrilallegrlvl-------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00464411   1/1  vidan.....gsieevveeilk------------------------------------------------
00477971   1/1  vl....l---------------------------------------------------------------
00487021   1/1  ell...eR..llkRgresergepldlleevleky------------------------------------
00379961   1/1  pagvtviaatnddlgeldpalld-----------------------------------------------
00478441   1/1  ----------------------------------------------------------------------
00426051   1/1  lerlar----------------------------------------------------------------
00475371   1/1  rilvldlg--------------------------------------------------------------
00437941   1/1  lsRfdviefpppdeeelleil-------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00379261   1/1  vgltdllgrtvdfkntiiiltsnvgelsgg----------------------------------------
00512891   1/1  lrrgrivelgplse--------------------------------------------------------
00533501   1/1  ekad.rvvvidag.....gsleevveeile.---------------------------------------
00496571   1/1  lialyegavvvidasglsleevveeile.-----------------------------------------
00475381   1/1  pd--------------------------------------------------------------------
00489571   1/1  ldd......Gtpeellarpanpyvrellgavpg-------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00468951   1/1  pallllde--------------------------------------------------------------
00493431   1/1  eelldiivvlllglilqpgsll------------------------------------------------
00498531   1/1  lldepgrvtqgldarllreilrllk---------------------------------------------
00510561   1/1  lsllldep--------------------------------------------------------------
00503741   1/1  lleegklt--------------------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00368571   1/1  gaektaasilellrkllallld------------------------------------------------
00511381   1/1  ll--------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00434401   1/1  lg--------------------------------------------------------------------
00490731   1/1  vlleglgvpgvvlNkldlva--------------------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00470731   1/1  hddel.arladr......gtlvliaale.lrg--------------------------------------
00444381   1/1  DEidkllddrgeaegggdvsre------------------------------------------------
00498811   1/1  eevvdrilal------------------------------------------------------------
00392701   1/1  rpeeldpallrpgrfdriieldlpdleerleil-------------------------------------
00513761   1/1  seeglelvlelleellellpilll----------------------------------------------
00499191   1/1  vi--------------------------------------------------------------------
00532471   1/1  dadpeell...eRllkRgrdpeeqe..rld----------------------------------------
00406781   1/1  dleeldpallrpgrfdrvielpl-----------------------------------------------
00405881   1/1  gtvvlvSahdge----------------------------------------------------------
00439861   1/1  kelgvtvilvsqlte-------------------------------------------------------
00489631   1/1  tddl...---------------------------------------------------------------
00404191   1/1  dqa-------------------------------------------------------------------
00513251   1/1  ldegslvdlgvledllaslepltnregldlvidlpl----------------------------------
00437921   1/1  leellpallsrfdiiefk----------------------------------------------------
00480251   1/1  alsvalilglpilflgtgenv.ddlevfnpgelvd-----------------------------------
00480441   1/1  elllaillal------------------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00499331   1/1  elyeeadrvividag.....lsieevv-------------------------------------------
00420941   1/1  rpeeldpallrpgRfdlvie--------------------------------------------------
00386741   1/1  ttnrpelldpallsRfdlvielp-----------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437901   1/1  llrRfdiiefpppdeeelleilkr----------------------------------------------
00378841   1/1  ----------------------------------------------------------------------
00469161   1/1  ld--------------------------------------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00533151   1/1  liepyeeaddvividasg.siee-----------------------------------------------
00367291   1/1  ll--------------------------------------------------------------------
00394721   1/1  ----------------------------------------------------------------------
00402371   1/1  lgeldpallrRfdv--------------------------------------------------------
00461621   1/1  ----------------------------------------------------------------------
00473941   1/1  ----------------------------------------------------------------------
00482551   1/1  lLkrlake--------------------------------------------------------------
00472911   1/1  kr....grallreevldrlle-------------------------------------------------
00487061   1/1  lvlpkp..................dlviyld...------------------------------------
00482721   1/1  lleaad.lvidndgslee----------------------------------------------------
00457851   1/1  ddvividas.lsieevveeilell----------------------------------------------
00521551   1/1  rp--------------------------------------------------------------------
00416171   1/1  elvlegelrpaLldRf------------------------------------------------------
00410531   1/1  saelalelakelgikfie----------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00517691   1/1  ----------------------------------------------------------------------
00496061   1/1  ......grllereddseevlekrlerylelyer-------------------------------------
00478391   1/1  vi--------------------------------------------------------------------
00516041   1/1  ----------------------------------------------------------------------
00478081   1/1  rerk------------------------------------------------------------------
00430121   1/1  ttnpglegivellldllllgrlrelv--------------------------------------------
00482661   1/1  ...-------------------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00489391   1/1  rperegdse-------------------------------------------------------------
00409841   1/1  ----------------------------------------------------------------------
00403151   1/1  ----------------------------------------------------------------------
00418301   1/1  ----------------------------------------------------------------------
00519581   1/1  ----------------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00441251   1/1  ----------------------------------------------------------------------
00463151   1/1  eera------------------------------------------------------------------
00477561   1/1  Rllkrrkedrpdlldkdleelleefegrddey.-------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00471271   1/1  ----------------------------------------------------------------------
00401211   1/1  dgallv----------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------
00477721   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00493981   1/1  ----------------------------------------------------------------------
00512061   1/1  ----------------------------------------------------------------------
00480501   1/1  ----------------------------------------------------------------------
00515801   1/1  ld--------------------------------------------------------------------
00486921   1/1  re--------------------------------------------------------------------
00479331   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00497571   1/1  ----------------------------------------------------------------------
00357861   1/1  ----------------------------------------------------------------------
00491901   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00486891   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00387321   1/1  ----------------------------------------------------------------------
00447401   1/1  ----------------------------------------------------------------------
00518511   1/1  ----------------------------------------------------------------------
00495821   1/1  ----------------------------------------------------------------------