[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81265.1


[Show Plain Result]

## Summary of Sequence Search
   1::342
  80::326  1.4e-25 27.7% 0051030 00510301 1/1   iction endonuclease-like                
   1::342


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGVLTRYLEETMAKARYDLVSPGRYVGELAEFGLRVEGENLEATRRALREALELHLLETLRSGLLPPGLE
00510301   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ATPDPLRERFFALAQEMWRLLREAPAPLPRPRKAPSLEEWLKGLGVQVVRRPEEGEEERERVLNRLALFL
00510301   1/1  ---------yldteserlvlldedgteklavqknlsiedllklhgarikklk....velsekldrllael


                         +         -         -         -         -         *         -:210
query           GDRYPSLERLYERLKQSLSTKRQFELSLAEASPEEIANSTQFCTLLKQYALLTSYRYKSEDRLLRAKAST
00510301   1/1  gerwkdlelvygeikrllnklaeidrksqellrllsesflgleelnkllgfLeeagllkvnldlltfrl.


                         -         -         -         +         -         -         -:280
query           EGWVQNFLTGGWLERYVAERLRKYLRSKNLPHEVAVGYQVTLPGGEAMELDVLVRVGERFYWFEAKTGEF
00510301   1/1  .......eealkFlnGewlEelVypalkelleergilvdvvlgveillkggedgvrnElDvlfvinnkly


                         -         *         -         -         -         -         +:350
query           QAHIAKYAGLKKVLGLSQKESFLVLLGMDRARAKELSALHGLTVVNQANFLEAFQEALGAHA--------
00510301   1/1  ivEcKsgelrddvdefleklealaklLggykakailVavdpidenl------------------------