[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81275.1


[Show Plain Result]

## Summary of Sequence Search
   1::618
   1::348 7.7e-113 38.8% 0052384 00523841 1/1   otidylyl transferase                    
   1::352 4.2e-100 39.0% 0042947 00429471 1/1   otidylyl transferase                    
   2::349  1.1e-99 42.6% 0043348 00433481 1/1   otidylyl transferase                    
   3::347  3.3e-96 39.7% 0039071 00390711 1/1   otidylyl transferase                    
   3::347  2.4e-95 38.3% 0037568 00375681 1/1   otidylyl transferase                    
   3::346    7e-94 37.2% 0038030 00380301 1/1   otidylyl transferase                    
   3::346  3.3e-88 37.4% 0038403 00384031 1/1   otidylyl transferase                    
   2::347  6.4e-81 37.1% 0040507 00405071 1/1   otidylyl transferase                    
   2::341  3.1e-62 32.0% 0047412 00474121 1/1   otidylyl transferase                    
   3::359    8e-62 35.1% 0048474 00484741 1/1   otidylyl transferase                    
   3::338  4.2e-57 30.2% 0039171 00391711 1/1   otidylyl transferase                    
   2::409  1.2e-50 32.4% 0048275 00482751 1/1   otidylyl transferase                    
   3::357  4.2e-44 26.3% 0038263 00382631 1/1   otidylyl transferase                    
   2::367  6.5e-44 25.5% 0035691 00356911 1/1   otidylyl transferase                    
 512::618  5.9e-38 57.0% 0048841 00488411 1/1   ic acid-binding proteins                
 513::617  1.9e-36 55.2% 0038054 00380541 1/1   ic acid-binding proteins                
 512::618  7.5e-36 52.3% 0048176 00481761 1/1   ic acid-binding proteins                
 517::617  3.5e-35 53.5% 0037641 00376411 1/1   ic acid-binding proteins                
 349::499  5.5e-35 37.1% 0052383 00523831 1/1   odon-binding domain of a subclass of cl 
 514::615    6e-35 52.0% 0048442 00484421 1/1   ic acid-binding proteins                
 350::532  3.6e-33 34.6% 0043347 00433471 1/1   odon-binding domain of a subclass of cl 
  17::412  4.4e-33 29.1% 0047114 00471141 1/1   otidylyl transferase                    
   2::370  2.7e-32 29.6% 0039322 00393221 1/1   otidylyl transferase                    
 511::617  7.9e-32 52.3% 0048839 00488391 1/1   ic acid-binding proteins                
 353::511  3.8e-29 35.1% 0042946 00429461 1/1   odon-binding domain of a subclass of cl 
 516::618  3.7e-19 40.4% 0048844 00488441 1/1   ic acid-binding proteins                
  18::367  6.2e-18 26.8% 0039570 00395701 1/1   otidylyl transferase                    
  18::326  2.8e-17 23.6% 0053312 00533121 1/1   otidylyl transferase                    
 349::477  6.2e-08 24.0% 0039069 00390691 1/1   odon-binding domain of a subclass of cl 
 350::477  2.8e-06 26.1% 0039227 00392271 1/1   odon-binding domain of a subclass of cl 
   8::382  1.1e-05 24.0% 0049118 00491181 1/1   otidylyl transferase                    
   5::360  9.4e-05 21.0% 0047487 00474871 1/1   otidylyl transferase                    
 353::491  0.00029 21.7% 0038401 00384011 1/1   odon-binding domain of a subclass of cl 
   1::618


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
00523841   1/1  gkkkflitvpppyvngplHlGhartyilaDvlaRylrmlGydvlfvpgtddhGlpielraeklgidprel
00429471   1/1  gkkkflitvpgpyvngllHiGHarnyilaDvlaRylrmlGydVlfvpgwDdhGlpielkaekfgetprel
00433481   1/1  -kkkflvtvpppyvngllHlGHarnayilaDvlaRylrmrGydVlfvpgtDdhGlpielkaekfgetpre
00390711   1/1  --etalpkfynllliekkwqkfweekklfeaflpldpgkkkfyvttppPypnGllHiGHarnyvlaDvla
00375681   1/1  --lalyntlnlpleefplrynlkeieekwqkyweekklfeallpllggkkkfyvtdppPypnGplHiGHa
00380301   1/1  --ialpgfinlflieekllklweeeklfefllegkkkfvvtvppPypnGplHiGHarsailgDvlaRylr
00384031   1/1  --PgfinlklieekllkiweelklfgklflpkgkkkvvvtfppPypnGplHiGHarsailgDvlaRylrm
00405071   1/1  -kkkvvvtvpgpyvngllHiGHarsyilgDvlaRylrmlGydVlfvpgiddhGlpiellaeefgelprel
00474121   1/1  -fppgkgkkvvversspnptgplHiGHarsavigdalaRllralGydVlrvngvddaGtqigllaaslll
00484741   1/1  --tk..vvvrfaPnPtGplHiGharsaligdllarylr..GydvlridDtD................per
00391711   1/1  --ynpleieeeilkklkkkkvvvvrtgpyPtGplHiGhargallgdvlarylrmlGydvlfvlgidDtgl
00482751   1/1  -gmslllklllirgllneltdekelfellegkpvrvycG.ptPtgplHlGhartal...vlarflr.aGy
00382631   1/1  --lWeeegifekdllkgkkkfvvtrfpPsPtGyLHiGharnallndllarylr..GyfvlriedtD....
00356911   1/1  -pflpgkkkkvvvefssPnptgplHiGHarsaiigdalarllrflGydVlrvngiddwGtqiellaeslk
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------gmsvdellelllrglyntltdekelfklleggpvrvycGidPTgdslHlGh...
00393221   1/1  -kenlelierglielwreeelfellekkkvrvy.tgpdPtgslHlGhlrgaikldvlara....gydvlf
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  -----------------lHlGh...lvpldklrrfqra.ghevlvliG.datgrigDpdgkiieralltl
00533121   1/1  -----------------vdlllelllrglietltdeeelfkllekgpvrvycGidPTgdslHlGhlr...
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00491181   1/1  -------ellvtPweveglsdegvdydklieefgielideellerlelltleellellrRglvfevtded
00474871   1/1  ----kvvtRfAPsPtGylHiGhartallnyllaray..gGkfllrieDtDperevpeavda.........
00384011   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELV
00523841   1/1  adeyiaeikedlkrlgisfdwfyrttdpeyieavqeiflkLlekGliyrgegpvyycpscetaladleve
00429471   1/1  adkyiaefkedlkrlgidwdrfyrttdpeyieavqeiflkllekgliyrgegpvyydpsdetaladle..
00433481   1/1  ladeyidefkedlkrlgisfdwfyrttdpeyieavqeiflklyekgliyrgegpvnycpscetaladae.
00390711   1/1  RylrmrGydVlfvpgwDdhGlpielaaeklldiddkiprkelgreefgetprelaeeyiaeikedlkrlg
00375681   1/1  rnyilaDvlaRylrmrGydVlfvpgwDdhGlpielraeklgktpedlgreeflelcrelaeeyideiked
00380301   1/1  mlGydVlfvpgwDdhGlpiellaeklgiklllriddlgreeflelprelaeeyideikedlkrlgisfdw
00384031   1/1  lGydvlfvlgiddhGlpiellaekfgedprelaeeyieeikedlkrlgisydwsreyattdpeyieavqe
00405071   1/1  adeyieefkedlkrlgisfdwfrptatl.yieavqelflkllekglayegdgavyydplekegdlgdlel
00474121   1/1  rgleepedlypieylldlyvklkklaedeeleeeagefllrledgdpkrladesieeikedlkrLgvdfd
00484741   1/1  lteeyidailedlkalgidwdeevrtqserl.dayqelfekllekGlayvcelsveflvelnlfyygr.l
00391711   1/1  pievkaeeegileeylgkpltgipdflgdprelaeeyideikedlkalgidpdwvsesslyksglykeii
00482751   1/1  dvlflig.Dahgliid.pagelg.lprelveenaaailedlkalgidpdkfiitaqseileiv.eliekL
00382631   1/1  ............pereteeyidailedlkwlglswdwsryyqserfdyy.qelflkLlekGlayrcfctv
00356911   1/1  llglellgeipeisylgeyyveiakelielgkdy.....tldpeleelareffrkleegdeeylklwqkl
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471141   1/1  lvtadvlrrflra.gydvillig.Dltgliddpigkratrvgldpeelrenaieailedlkalgidp...
00393221   1/1  lig.Dlhgliidpa.......pkelvrenieeikeqllalgldp..........................
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  elvdenieyikkllakgldydg................................................
00533121   1/1  aldvl.rylqdagydvilliadltdliddkilkraerlgenlldpeelae.nieeyaadllalgldp...
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00491181   1/1  ellelleegkplrvytGfdPTgdslHlGh...lvgalklrrllqalgheviil.iaDlhaligdp.....
00474871   1/1  .......iledlewlgldwdegp.dpggplgvyyqserfdlyyeaaeeLiekglaYvcfctreelealr.
00384011   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
00523841   1/1  dpvcwrsgapvevrlteqwflklsklkdkllekldpldfalwpesvkgellnwlenglrdwcisRqswdr
00429471   1/1  ...cwrsgtpvelrateqwflklgkladrllealeege..w.peevrnrldnwlekglkdwcisrq..rl
00433481   1/1  ....cwrsgtpvevrlteqwflklgklkdrllealekle..w.pesvknrllnwlenglrdwciSRq...
00390711   1/1  isfdwsrfyrTtdpeyieavqelflkllekgliyrgegpvnydpsdetaladaeveggeypvcwrsgtpv
00375681   1/1  lkrlgisfdwdrfyaTtdpeyieavqelflkLyekGliyrgdgpvyycpscetaladrevegypvcwrsg
00380301   1/1  frpyattdpeyieavqevflkllekGliyrgerpvyydpscetaladaev.epvcwrsgtpvevrlteqw
00384031   1/1  iflklyekGliyrgerpvnycpsdetaladaeveypvcwrskgdpvelrlteqwflklskladrlleale
00405071   1/1  ikldgpvcyrsgdpvelkltpqwfv................................llkglkdwaisRq
00474121   1/1  ryvresesyysgavqeviekLlekGlayekellvndgavlfrlekfgddgeledrvllksdGtptyl...
00484741   1/1  sngevpe............................................leavlrllvdlgklvprdl
00391711   1/1  trqseyieliqeilekllekglayekdgtvnflprcktalgdlsvevkk.....................
00482751   1/1  lekglayealnrmvyfd.....................................................
00382631   1/1  ewlpalrtalaeagvepkyrgrsrelnlelviattrpetlegdyalrl................kidles
00356911   1/1  vdrsleefkedlkrlgvkfdvyrgestlyidgiievvelleekgllyesdgavyfdltkfgd........
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471141   1/1  ......................................................................
00393221   1/1  ................................................ekwtifrqsdwgeyiellldlg
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  ...............................................................pekvti.
00533121   1/1  ......................................................................
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00491181   1/1  ......................................................................
00474871   1/1  gklpgydgtcrdlsveenlalleegrpgvlRlkidldgpivfndllrgpvlfria.algdfvllrsdgyp
00384011   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
00523841   1/1  ywGvpiPgwetdvldvWfdsslmylaylgapledlfelwwpadihvgGkDliffhllrlialllalggep
00429471   1/1  ywGvpiPgwekdvldvwfdsgiyyieclaapllklgdkedfekwwpadgvdelihvgGkDliffhllysl
00433481   1/1  rywGvpipvwiekddgkviyvwfdalvgyptglgrpgekleretdvldtwfdsgwypadihvgGkDiirf
00390711   1/1  evrlteqwflklgkladrlleal.esgewippevvrkrllnwle.glrdwciSRq...ryWGvpiPiwyc
00375681   1/1  apvevrlteqwflklsklddrllkalkkge..fvpeevknrlrnwle.nlrDwcisRqrp...WGvpiPv
00380301   1/1  flklgkladrllealeegervivpeevknrldnwle.glrdwcisRq...rywGvpiPgwhiedgamvvv
00384031   1/1  ele..wrpevvrk.rlewileglrdwciSRq...rywGvpiPvwycescliesvydellpvvlgeleegg
00405071   1/1  rp...wGvpiPgwhidvldvwfdsl.................glpvdihvgGkDliffhllyeiaileal
00474121   1/1  .........................................lrDlaisrqrf...wghpipgwespwgdv
00484741   1/1  vlgalwidlpgdeddwvivwgdglpgY.....dlavvvddallgidivvrGkDllfphalye.allealg
00391711   1/1  .............................................wgdgipl.ykakdiadvwfdspwgy
00482751   1/1  .........................................dvvdvwfdg..wsiglf.ypllqaadill
00382631   1/1  glenl.rDwvisrq...rywghdipllrsdglptyflavvvdda............llgithvlrGaDhl
00356911   1/1  ....................dlrdwvisr...............sdggytYftsdiayaly......rfe
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  ----------------------------------------------------------------------
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  ----------------------------------------------------------------------
00471141   1/1  .......gkayifnnsdylpvlsfldylrlsglvsvnrllrgddvkdrlekdlpisfgl...........
00393221   1/1  klttvgell...........rrddvkdrwdssisfgllgYpllqaadil..............llgvdiv
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  vnnsdwlsklnlidflrdlgkhvsvnrmlarddfalrledgislgeflYpllqayDflhlecgygvdlqi
00533121   1/1  .....................................ekvtiflnsdvlshleladllrglarvgtlnrm
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00491181   1/1  ...........................ldleeirenieeliaqllalgldpdktfivnnsdwlgklswyl
00474871   1/1  tY.........dlavvvdDalmg..................iThvirGedlldstprqi.llyealglp.
00384011   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
00523841   1/1  fknvlvhglvldldgeKMSKSlgnvvdprdllegygadalRlyllslapygsdldfseellveavnfl--
00429471   1/1  aillalgleppknvllhgfvll.dgeKMSKSlGnvitpddllekygadalRlfllsalapygsdldfsee
00433481   1/1  hllyspaillaarmlgllleltgleppknvlvhgfvll.dgeKMSKSlgnvidpldlldkygadalRly-
00390711   1/1  edlgdvvvieavlelvdpldfvlwksddlgeplwdlvvlcpkcglelkrdtdvldvWfdSglgylgr---
00375681   1/1  whiedgaivyvaediaylllkaieggtdllltlelldllvlyyvllgklglelkretdvldvWfdSg---
00380301   1/1  llgdgavllptytfgddgdlvlresdvldtwfdsglyylstldlavdkekfellfpvdiyvgGkDl----
00384031   1/1  llleadgdllsllgdlkdfvllksdgpleretdvldvWfdSgwgylrvlgyptedlayileklerw----
00405071   1/1  fgleppkyvlhhgf.ldldgeKMSKSlGnvitprdlleeygadalRlflls.asyrsdldfseelll---
00474121   1/1  lptwfiellayvv.........ddlgfdvdiyvvGadhi.lhferlrailealgllplapp---------
00484741   1/1  lpppeyvhhglv.lnldgeKmSK..Gn.vtl..lldegygpdalryfllr.lgyssdldfslealeeavn
00391711   1/1  grpgyplecaaddlllgvdivlgGkDhifphllylpaqrealealgleppkvllyhgv------------
00482751   1/1  lgadivlgGkDq.ffhlelgralaralglpfpevlthpl.llgldGeKMSKSlgnsvitlldlleeygad
00382631   1/1  fnt.lryilllealglpfpkvlhh.glvldldgekmSKskgnvvvpldlidgygdprlptlaglrrrGyl
00356911   1/1  rlgfdkdiyvvgadq.llhfaqlfaalaalgyepakkvlhvgfvlv..g.kMSkrkGnvvtlddlleeyg
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  --------------------------------------------------------------------La
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  ---------------------------------------------------------------------a
00471141   1/1  ......ftYpllqaadilhlgadivlgGkDq.fphhelgralaralggkpp.yvlhhplllgldGteKMS
00393221   1/1  pgGkDqwphhelgreiar......pfpvllthplllgldGveKMSKSkgnvitlddlleeiakkikkaft
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  ----------------------------------------------------------------------
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  gGsDq.fpnillgrdllrallglpkpvglttp.lllgldGeKMSKSlgnaiwlddllksiykkiqkalnv
00533121   1/1  ldpkdfvlrkadgiseglftypllqaaDilhlylgegadivpgGsD------------------------
00390691   1/1  --------------------------------------------------------------------fy
00392271   1/1  ---------------------------------------------------------------------y
00491181   1/1  sflldlgrlfrvnqmkerfglekgi.................slgefsYpllqaaDilhlelsallkadg
00474871   1/1  vPvyahlplllnldgtkLSKrkgaptllglrrrgylpealrnflll.lgwsksdalldfsllelierfdl
00384011   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAKRLRPLVRELKFHVALEEAMAYVKALNRYINE
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ll--------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00484741   1/1  ..lafklgn-------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00482751   1/1  ilryfllsgnyrddd.vldfselilflaldllnklrnalrfgplllealeelaeeytsg-----------
00382631   1/1  adalrlf---------------------------------------------------------------
00356911   1/1  adalrlflls.kspdsd-----------------------------------------------------
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  ndlgNlvnRvlsfiakyfdgvvpteadkellalllelleevaeameklefrkaleeimelarlaNkyide
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  nklgNllnRtlrfilknldgfvpdleelteldrwllsrlnelikevteayenyefnkalraimelvnlan
00471141   1/1  KSlgnaitlddllekigpkilryydalls.thyrlpldfsleellelldlllrlknarlaql--------
00393221   1/1  dprevygadalryfllsglp--------------------------------------------------
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  --lgNllnRtlsfilkyfdgvvpateldrellallnelleevaeayenlefskaleeimelaslaNkYid
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  ydadvlrylllftfldl-----------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00390691   1/1  nklwnalrFllrnlnlfdklldgalpleelslldrwilsrlnelikevteayenyrfntavaalyefvnd
00392271   1/1  nklwn....aarFllrnldgfdpdleelslldrwilsrlnelikevteayekyrfntalsalyefvwndl
00491181   1/1  dlldlvpgGsD.Qrphielgrdlarrlnlpep--------------------------------------
00474871   1/1  nrvakrpaav------------------------------------------------------------
00384011   1/1  --Flnklwnlvrfllenldgfdplldleelslldrwllsklnetikkvtealekyrfntaisalmefvna


                         -         -         +         -         -         -         -:490
query           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00484741   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00488411   1/1  ----------------------------------------------------------------------
00380541   1/1  ----------------------------------------------------------------------
00481761   1/1  ----------------------------------------------------------------------
00376411   1/1  ----------------------------------------------------------------------
00523831   1/1  tePWklakedperlatvlylllellrllaillaPflPelaekildqLgldeevrlldwlelglllaghkl
00484421   1/1  ----------------------------------------------------------------------
00433471   1/1  wYldlskpwllakedserlravlyvllevlrillillaPflPfiaeeiwqqlglee...svhlaswplld
00471141   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00488391   1/1  ----------------------------------------------------------------------
00429461   1/1  etkPWklakddpdlerlaavlyvllellrllaillaPilPflaeeildqLglelsvrs.....ldlllag
00488441   1/1  ----------------------------------------------------------------------
00395701   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00390691   1/1  dlsnwYlelikdrlygeadsearraaltvlyevletllrllaPflPfiaeelWqrlp-------------
00392271   1/1  sdwYlelikprlyae.....drsaqtvlyevletllrllaPflPfiaeelwqrlgge-------------
00491181   1/1  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00384011   1/1  lsdwylelakdr...............vllealetllrllaPfaPhiaeelWqllgg....gsvllapwP


                         *         -         -         -         -         +         -:560
query           EEAPVLFPKKEAKVEAKPKEEAWIGIEDFAKVELRVAEVLAAEKHPNADRLLVLRLSLGNEERTVVSGIA
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00484741   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00488411   1/1  ---------------------elieiddflkvdlrvgkvleaekhpdadkllvltvdlGeeprqivagia
00380541   1/1  ----------------------lisiddflkldlrvGkileaekvpdadkpllvltvdlGelevrqvvag
00481761   1/1  ---------------------eeieiddfllvdlrvgkvleaekhpdadkllvlkvdlgeelrqivagaa
00376411   1/1  --------------------------ddfskldlrvGkileaekhPdAdkLyvlkvdvGegeprqivsGa
00523831   1/1  gkpepLfpr-------------------------------------------------------------
00484421   1/1  -----------------------ieildfslldlrVGkvlevekhPdadkLyvlkvdvgeeeprqivsga
00433471   1/1  ghkigk.peplferledeeleelieqlkgliravrkareean----------------------------
00471141   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00488391   1/1  --------------------veeieiddfllvdlrvgkvleaekhpdadkllvlkvdlGeelrqivagaa
00429461   1/1  hklnkpeplfprieleeieal-------------------------------------------------
00488441   1/1  -------------------------ldlll..dlvvgkvlevekhp.adkLlvlkvdvg.ellqivcGap
00395701   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00384011   1/1  e---------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           KWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGEALALVTVEGEVPPGAVVK------------
00523841   1/1  ----------------------------------------------------------------------
00429471   1/1  ----------------------------------------------------------------------
00433481   1/1  ----------------------------------------------------------------------
00390711   1/1  ----------------------------------------------------------------------
00375681   1/1  ----------------------------------------------------------------------
00380301   1/1  ----------------------------------------------------------------------
00384031   1/1  ----------------------------------------------------------------------
00405071   1/1  ----------------------------------------------------------------------
00474121   1/1  ----------------------------------------------------------------------
00484741   1/1  ----------------------------------------------------------------------
00391711   1/1  ----------------------------------------------------------------------
00482751   1/1  ----------------------------------------------------------------------
00382631   1/1  ----------------------------------------------------------------------
00356911   1/1  ----------------------------------------------------------------------
00488411   1/1  nvyvpealvGklvvvvvnlkprklrgveSegmvlaaselglvvlllldedvpvGtrvl------------
00380541   1/1  ianlyapeelvgklvvvvanlkprklrgvlSegmvlaasdedgevvlllpdegaplG-------------
00481761   1/1  nvyvpealvGklvvvvvnlkprklrgveSegmllsaselglvgllvldedapvGtrll------------
00376411   1/1  pnvyvpealvgalvvvvanlkpaklrgveSegMllsasedekvgllelpedapvGer-------------
00523831   1/1  ----------------------------------------------------------------------
00484421   1/1  pnvyvpealvGalvvvvvnlkpaklrgveSeGMllsaselgldekvgllvlpeda---------------
00433471   1/1  ----------------------------------------------------------------------
00471141   1/1  ----------------------------------------------------------------------
00393221   1/1  ----------------------------------------------------------------------
00488391   1/1  nvyvpealvGklvvvvvnlkprklrgveSegmllsaselglgsvgllvldedapvGt-------------
00429461   1/1  ----------------------------------------------------------------------
00488441   1/1  nvragllvvvalvGallpvlglnlkpaklrGveSeGmllsaselglsddsdgilvlpe------------
00395701   1/1  ----------------------------------------------------------------------
00533121   1/1  ----------------------------------------------------------------------
00390691   1/1  ----------------------------------------------------------------------
00392271   1/1  ----------------------------------------------------------------------
00491181   1/1  ----------------------------------------------------------------------
00474871   1/1  ----------------------------------------------------------------------
00384011   1/1  ----------------------------------------------------------------------