[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81311.1


[Show Plain Result]

## Summary of Sequence Search
   1::259
   3::256  1.4e-68 41.0% 0037958 00379581 1/1   p containing nucleoside triphosphate hy 
   3::253  5.7e-66 42.6% 0047589 00475891 1/1   p containing nucleoside triphosphate hy 
   1::249  4.9e-64 42.3% 0044086 00440861 1/1   p containing nucleoside triphosphate hy 
   3::256  1.7e-63 39.6% 0036121 00361211 1/1   p containing nucleoside triphosphate hy 
   2::261    2e-63 36.4% 0045860 00458601 1/1   p containing nucleoside triphosphate hy 
   1::243  2.9e-63 41.2% 0037898 00378981 1/1   p containing nucleoside triphosphate hy 
   3::243  6.8e-63 43.0% 0050044 00500441 1/1   p containing nucleoside triphosphate hy 
   3::252  1.2e-62 40.8% 0047599 00475991 1/1   p containing nucleoside triphosphate hy 
   6::234  1.5e-62 37.6% 0039041 00390411 1/1   p containing nucleoside triphosphate hy 
   3::238  1.6e-62 40.9% 0042280 00422801 1/1   p containing nucleoside triphosphate hy 
   1::256  1.7e-62 39.4% 0048220 00482201 1/1   p containing nucleoside triphosphate hy 
   4::250  7.6e-62 38.4% 0049080 00490801 1/1   p containing nucleoside triphosphate hy 
   2::257    1e-61 38.8% 0048226 00482261 1/1   p containing nucleoside triphosphate hy 
   3::250  1.6e-61 37.7% 0051025 00510251 1/1   p containing nucleoside triphosphate hy 
   1::243  2.8e-61 40.8% 0042070 00420701 1/1   p containing nucleoside triphosphate hy 
   3::255  7.7e-61 39.9% 0053059 00530591 1/1   p containing nucleoside triphosphate hy 
   2::257  8.3e-61 40.8% 0050274 00502741 1/1   p containing nucleoside triphosphate hy 
   5::251  3.5e-60 41.5% 0040410 00404101 1/1   p containing nucleoside triphosphate hy 
   4::243  1.8e-59 41.0% 0042557 00425571 1/1   p containing nucleoside triphosphate hy 
   4::238    6e-59 38.4% 0036790 00367901 1/1   p containing nucleoside triphosphate hy 
   3::239  1.7e-58 41.8% 0046697 00466971 1/1   p containing nucleoside triphosphate hy 
   9::238  2.9e-57 38.8% 0046693 00466931 1/1   p containing nucleoside triphosphate hy 
   2::226  7.6e-57 44.0% 0043607 00436071 1/1   p containing nucleoside triphosphate hy 
   1::244  1.6e-55 45.6% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::255  2.1e-55 36.9% 0050943 00509431 1/1   p containing nucleoside triphosphate hy 
  10::249  2.1e-53 38.0% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   1::245  6.4e-53 35.1% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
   3::243  3.3e-52 37.7% 0049537 00495371 1/1   p containing nucleoside triphosphate hy 
   1::244  5.2e-51 39.7% 0046869 00468691 1/1   p containing nucleoside triphosphate hy 
   3::247  1.5e-49 37.1% 0046945 00469451 1/1   p containing nucleoside triphosphate hy 
   5::256  1.6e-49 35.0% 0049611 00496111 1/1   p containing nucleoside triphosphate hy 
  21::249  3.7e-49 38.6% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   3::239  8.6e-49 38.6% 0042496 00424961 1/1   p containing nucleoside triphosphate hy 
  24::248  1.5e-48 42.4% 0048593 00485931 1/1   p containing nucleoside triphosphate hy 
   3::243    2e-48 36.4% 0050061 00500611 1/1   p containing nucleoside triphosphate hy 
   3::221    3e-48 38.6% 0043651 00436511 1/1   p containing nucleoside triphosphate hy 
  19::249  3.5e-48 40.9% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
   3::253  1.1e-47 38.8% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
   4::243    3e-47 41.9% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
   3::244  8.6e-46 36.4% 0048852 00488521 1/1   p containing nucleoside triphosphate hy 
   1::241  1.9e-43 35.5% 0050337 00503371 1/1   p containing nucleoside triphosphate hy 
   3::250  8.4e-42 34.5% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   3::249  2.2e-41 33.7% 0037163 00371631 1/1   p containing nucleoside triphosphate hy 
   3::244  2.4e-40 38.6% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  18::253    2e-39 32.2% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   3::243  1.1e-38 32.2% 0049503 00495031 1/1   p containing nucleoside triphosphate hy 
   3::234  1.5e-38 41.4% 0046479 00464791 1/1   p containing nucleoside triphosphate hy 
  29::198  1.9e-36 40.0% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
  27::243  1.6e-35 36.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
  16::246  5.8e-35 39.0% 0053253 00532531 1/1   arboxykinase-like                       
  27::244  3.1e-34 36.8% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
   1::141  7.3e-34 45.0% 0038720 00387201 1/1   p containing nucleoside triphosphate hy 
   6::252  1.2e-31 34.1% 0048957 00489571 1/1   p containing nucleoside triphosphate hy 
  21::253  1.9e-31 26.4% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
  14::215  2.1e-31 36.9% 0047841 00478411 1/1   arboxykinase-like                       
  27::227  4.7e-30 33.9% 0047797 00477971 1/1   p containing nucleoside triphosphate hy 
  23::183  6.1e-30 37.7% 0048047 00480471 1/1   p containing nucleoside triphosphate hy 
   9::226  5.3e-29 30.3% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
  28::204  1.7e-28 36.8% 0051553 00515531 1/1   p containing nucleoside triphosphate hy 
  13::228  1.3e-27 31.9% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   1::245  2.1e-27 26.4% 0036850 00368501 1/1   p containing nucleoside triphosphate hy 
  30::238  5.7e-27 33.9% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
   4::230  2.2e-26 29.9% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
   4::244  2.2e-26 31.5% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
  29::242  3.1e-26 32.5% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
  28::207  5.5e-26 34.6% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
  28::246  5.5e-26 30.5% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
  16::200  8.5e-26 38.6% 0047552 00475521 1/1   arboxykinase-like                       
  26::246  1.1e-25 34.0% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
  27::228  2.3e-24 34.8% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
  27::231  2.8e-24 34.6% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   5::254  6.9e-24 31.7% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
  28::225  1.1e-23 32.0% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   1::232  2.3e-22 27.1% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
   1::232  4.3e-22 25.8% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
  26::252  7.4e-22 33.0% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
  14::214  1.2e-21 32.7% 0047844 00478441 1/1   arboxykinase-like                       
  30::234  2.3e-21 25.1% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
  28::200  4.1e-21 36.1% 0051551 00515511 1/1   p containing nucleoside triphosphate hy 
   5::232  5.7e-21 28.7% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
   6::209  2.6e-20 29.0% 0035641 00356411 1/1   p containing nucleoside triphosphate hy 
  20::235  3.4e-20 29.6% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
  18::252    6e-20 26.1% 0037926 00379261 1/1   p containing nucleoside triphosphate hy 
  30::248    6e-20 23.9% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
  21::239  1.3e-19 26.3% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
  16::227  7.1e-19 40.9% 0040419 00404191 1/1   p containing nucleoside triphosphate hy 
  29::228  1.7e-18 27.0% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
  23::249  3.1e-18 25.0% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
  29::240  1.4e-17 30.0% 0040588 00405881 1/1   p containing nucleoside triphosphate hy 
   7::210  2.7e-17 22.4% 0047701 00477011 1/1   p containing nucleoside triphosphate hy 
  22::206  1.8e-16 32.7% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
  24::209  2.2e-16 32.5% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
  28::252    4e-16 24.7% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   5::229  3.4e-15 22.5% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
  13::230  3.7e-14 30.9% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
  16::246  6.6e-14 25.4% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
  13::228  1.6e-13 29.8% 0040678 00406781 1/1   p containing nucleoside triphosphate hy 
  23::208  4.1e-13 30.6% 0043218 00432181 1/1   p containing nucleoside triphosphate hy 
  28::221  4.8e-13 27.3% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
  30::218  2.3e-12 25.9% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
  22::225  2.2e-11 26.1% 0051769 00517691 1/1   p containing nucleoside triphosphate hy 
  18::244  3.5e-11 28.7% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
  26::201  8.6e-11 30.1% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
  23::251  9.8e-11 24.6% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
  28::227  1.1e-10 25.3% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
  18::222    2e-10 25.9% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
  22::226  5.9e-10 25.9% 0040984 00409841 1/1   p containing nucleoside triphosphate hy 
   8::225  1.1e-09 24.4% 0048255 00482551 1/1   p containing nucleoside triphosphate hy 
  22::213  1.2e-09 29.1% 0043790 00437901 1/1   p containing nucleoside triphosphate hy 
  16::222  2.5e-09 33.9% 0038674 00386741 1/1   p containing nucleoside triphosphate hy 
  18::240  3.7e-09 23.5% 0039472 00394721 1/1   p containing nucleoside triphosphate hy 
  31::229  4.1e-09 27.3% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
  29::201  5.2e-09 27.1% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
  18::213  6.1e-09 25.4% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
  28::217  7.5e-09 28.6% 0051958 00519581 1/1   p containing nucleoside triphosphate hy 
  13::68   3.4e-08 37.0% 0041032 00410321 1/1   p containing nucleoside triphosphate hy 
  22::244  3.6e-08 28.9% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
  29::252  4.7e-08 26.8% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
  25::68   5.4e-08 36.4% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
  24::238  5.7e-08 24.0% 0040237 00402371 1/1   p containing nucleoside triphosphate hy 
  23::226  6.6e-08 26.9% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
  21::73   1.7e-07 32.1% 0049577 00495771 1/1   p containing nucleoside triphosphate hy 
  25::68   1.1e-06 31.8% 0040121 00401211 1/1   p containing nucleoside triphosphate hy 
  23::178  1.5e-06 26.1% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
  28::222  2.2e-06 26.8% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
  25::221  2.5e-06 30.1% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
  29::227  2.7e-06 27.3% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
  25::250  4.6e-06 24.1% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
   2::68   5.3e-06 25.4% 0047127 00471271 1/1   p containing nucleoside triphosphate hy 
  24::221  1.3e-05 23.7% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
  22::212  1.7e-05 23.6% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
  27::224  1.7e-05 25.4% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
  29::106  1.8e-05 24.7% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
  17::236  1.9e-05 20.9% 0041053 00410531 1/1   p containing nucleoside triphosphate hy 
  11::218    2e-05 22.0% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
  29::66   2.2e-05 31.6% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
  29::178  2.9e-05 26.4% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
  28::178  5.9e-05 22.9% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
   5::206  6.1e-05 23.8% 0041617 00416171 1/1   p containing nucleoside triphosphate hy 
  14::51   7.4e-05 31.6% 0037862 00378621 1/1   p containing nucleoside triphosphate hy 
  32::68   0.00024 27.8% 0052346 00523461 1/1   p containing nucleoside triphosphate hy 
   5::49   0.00029 22.0% 0047023 00470231 1/1   p containing nucleoside triphosphate hy 
  27::217  0.00031 22.9% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
  28::134  0.00035 31.6% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
  20::62   0.00044 27.9% 0041400 00414001 1/1   p containing nucleoside triphosphate hy 
  18::68   0.00075 23.5% 0048819 00488191 1/1   p containing nucleoside triphosphate hy 
  25::233   0.0008 23.5% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  28::196  0.00094 24.2% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
   1::259


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS
00379581   1/1  --lepllevenlsksyggvlalkdvsltvkpgeivalvGpnGsGKSTllkllagllkptsGeilldgldi
00475891   1/1  --lllelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgk
00440861   1/1  MpllslgepllelenlsksyggvvalkdislsipkGeildlldellellkeldgsllnvalvGpsGsGKS
00361211   1/1  --plellgepllelenlsksyggitalddvslgirkGeivllvGpsGsGKStllrnllagllaptggsvl
00458601   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkditgl
00378981   1/1  lpllelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllll
00500441   1/1  --lllelllelknlsksyggvlalddvsltikpgeivalvGpnGaGKSTllkllagllkptsGeilldgk
00475991   1/1  --lllaaelpelgelllevvnlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkpts
00390411   1/1  -----MknlslrygnfralkdvslelppG.ltalvGpNGsGKStLlkalagllgpdsglrvgklsdlirr
00422801   1/1  --llllllallllllllllldpllelenlsksyggrlvlalkdvsltvkpgeivalvGpnGsGKSTllkl
00482201   1/1  llllelknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00490801   1/1  ---llllllllalllelleeeeellllllalllllgdpllelenlsksyggvpalkdvsltikpGeival
00482261   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdildl
00510251   1/1  --lllllllllaeellelleeeelllllllllllllgdpllelenlsksyggvpalkdvsltikpGeiva
00420701   1/1  lpllelenlsksypgggvlalkdvsltvepgeivalvGpnGsGKSTllkllagllkptsGeilldgldll
00530591   1/1  --llllllaleelpllgelllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagll
00502741   1/1  -lllevenlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkdilgl
00404101   1/1  ----elenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagll.ptsGeilldgldltal
00425571   1/1  ---lelenlsksyggvlalkdvsltvepgeivalvGpnGaGKSTllkllagllkptsGeilldgldllal
00367901   1/1  ---lelknlslsyg.ksilkdvsleip.geltalvGpnGsGKStllkalagllgpdvsallrlsglidli
00466971   1/1  --llalllevknlsksyggvlalkdvsltikpgeivalvGpnGsGKSTllkllagllkptsGeilldgkd
00466931   1/1  --------Mkllslslgnfralkdvslelp.geltalvGpNGsGKStLlkalagllgpdsGeilldgkdi
00436071   1/1  -pllelenlsksygg.lalkdvsltvepgeivalvGpnGaGKsTllkllagllkptsgeilldgldlla.
00372301   1/1  yvlPllsdgmpllelenlrkpyggllvlndvsl...pgeivaltGpnGaGKSTllrllaglllpasggil
00509431   1/1  M..lelknlslsnfr..vlkdelvslefepg.ltaivGpNGsGKStlldalagllggrslrllragglsd
00485451   1/1  ---------skiygd.ealkdvsleikkllnlsgkpgeiigivGpsGsGKsTllrlLagllkpllltggk
00498251   1/1  vekllglalllieklflkvlprllsllelenlskiytgipal.dvslglgGlppGeivlllGpsGsGKTt
00495371   1/1  --esalellleledltklstgikaLddv.lggglpkGeivlllGpsGsGKttlalrllagllkp...evl
00468691   1/1  lsvpvglallgrvldvlgepidglgplllllllpivrlappllelenlsksygtgialidvsltigrGer
00469451   1/1  --allelenlskiyggvpkalddvslgiepGeivalvGpsGsGKstllrllagllaglptsGeillldgk
00496111   1/1  ----elenltklytgikaLddllslgippGeivllvGpsGsGKTtlalrllagllkptggkvliiglels
00468601   1/1  --------------------dlslevkkgevialvGpnGvGKTTllakLagllapqggkvlllgaDiyra
00424961   1/1  --lgepldglgplrpapgllelenvsksygtgialidlslpigkGervalvGpsGaGKttLlrliaglld
00485931   1/1  -----------------------LsvpkgevvalvGpnGaGKTTllallagllaptggkvllvgadi...
00500611   1/1  --pgllsllelllelenltklptgipaLddv.lgggipkGeivllvGpsGsGKTtlllqlagllapdsge
00436511   1/1  --ievpvglallgrvldllgepidgkgplelgepllevenlsksyggrklvlepletgialddvsltikk
00448931   1/1  ------------------LddvslsvepgevialvGpnGsGKTTllnalagllapdggkvllvgadiarl
00367481   1/1  --yvrPelldepllelengrhPllsksyggkvvlndislsip.gellvitGPngsGKSTllralaglllp
00379601   1/1  ---llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllvvld
00488521   1/1  --lllllalelllevenlristgikeldkllsgglppgeitlivGpsGsGKTtLllqlavngllppdsGe
00503371   1/1  Mmlksl.....elknfkslkdvsligdfspg.ltaivGpNGsGKStlldaiagllgpdsgeirldgkdll
00422141   1/1  --dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvlielifl
00371631   1/1  --mseliiylelselewallradvgltlteaelkrlkglndlleledlskiygplsrlikllleellrll
00437981   1/1  --lveklrpknldkvigqeealkdlslalkpgeiphalllvGppGsGKttlaralagllgpdsgkilldg
00475371   1/1  -----------------alddvslsikkgevialvGkgGvGKTTlaanlagllaptggkvlligaDirrp
00495031   1/1  --lsalellleledltkistgipaLddvlsggipkGelvllvGpsGsGKTtlllqlagllalglgliplg
00464791   1/1  --lsvpvgdkllGrvldvlgepidglgpllalerlpierlappllelenlskrfgtgivlidvslpigkG
00381441   1/1  ----------------------------GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprl
00457311   1/1  --------------------------mkkgeiigivGpsGsGKSTlarllagllekpgsgvividgddly
00532531   1/1  ---------------vlalkdvslviekGevvallGlSGsGKTTLlrllagllipddgeilidggdinle
00414121   1/1  --------------------------kpgevvllvGpsGaGKTTLlrallglleglkvaviepdfgeili
00387201   1/1  mssgepllevenlskryggklalkdvslsvekgeivlLlGpnGaGKTtLlralagllgptsfvvsptftl
00489571   1/1  -----rvknlsksyggktalddvslsvepG.ivgLlGpNGaGKSTllrllaGllkpt.............
00490731   1/1  --------------------dvslsvkkgkvialvGkgGvGKTTlaaklagllakrggkvllidaDpyrp
00478411   1/1  -------------Ggvlalhgvsldve.gevvlltGpsGsGKStllralagl.....Gtilldg.dlvrl
00477971   1/1  --------------------------hkgelvvlvGPsGaGKsTLlnaLlgll.ptsgvisvsgttr...
00480471   1/1  ----------------------sleikkgekvaivGpsGsGKSTLlnaLagllsptsvpettrdfilgei
00434401   1/1  --------lsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyr
00515531   1/1  ---------------------------kgekvallGlsgsGKSTllnrllglefaygpTigptsgtieid
00462761   1/1  ------------yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddl
00368501   1/1  kerllllelrnvllddviGqeeakealsealelplkrpelfdglgvelpgknvlLvGppGvGKTtlaral
00512891   1/1  -----------------------------evilltGppGvGKTTlakalagelgakfgsvsltgrdv...
00379961   1/1  ---yrpvdfddivGqeealralslalaagppegvllvGppGtGKstlaralagllppdsgrivlvgnlsd
00437941   1/1  ---lrplveklrpknlddvygqeevlkalslalekgrpehlllvGppGtGKTtlakalaglllptsggvr
00533501   1/1  ----------------------------rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepig
00484101   1/1  ---------------------------kgpvigivGpsGsGKTTllraLagllkprggrvavigldigrl
00493431   1/1  ---------------------------kGelivllGpsGaGKsTllkllagllgptsgvisvggttrepr
00475521   1/1  ---------------evlalhgvsldve.gevvllvGpsGsGKStllralag.....sGeilvdg.dlvd
00464411   1/1  -------------------------vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsge
00426051   1/1  --------------------------kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdl
00475381   1/1  --------------------------mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavl
00503741   1/1  ----fifldlrplallplpdrlvgrdeeiealskalgg..aldgvslsiepggivllvGppGvGKTtLak
00496571   1/1  ---------------------------GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirg
00468951   1/1  lnvlgesidalgkilseilkllekgfltalgllerksverlstgikaLDll.lgiGglprGelvlivGpp
00510561   1/1  ldglgepldgllpilaklfrpievlalgllerksverlstGikaLDll.lgiGglprGelvliaGppGsG
00487021   1/1  -------------------------rm...kiivltGpsGsGKsTlarlLaell....gvvvidtddllr
00478441   1/1  -------------aevlalhgvsldin.gegvlivGpsGsGKStlalaLagl.....Gailvdd.dlvll
00480441   1/1  -----------------------------rlivllGpsGaGKsTlaklLaell.p..glivisvgdttr.
00515511   1/1  ---------------------------kgekvlllGlsgsGKSTllnrllgleflpgpTigptegtieid
00498531   1/1  ----ldklgkildlalkileksflklevlalgvlerkeverlstGikaLDal.lgiGglprGsltliaGp
00356411   1/1  -----lknlsksygilkalkdislelkkgikilllGlsgsGKSTllnrllgleygpTiginegtieidgv
00368571   1/1  -------------------llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlgelgr
00379261   1/1  -----------------drllleelrpvllddviGqeeakealsealrlplkrlelferlglrrpgknvl
00513761   1/1  -----------------------------kiiaivGkgGsGKTTllnklaglla.dggkvlvidlDpa..
00480251   1/1  --------------------EdlslavgkgkvialvGkgGvGKTTtaakLaaalaergkkvllidlDpyr
00404191   1/1  ---------------vellpkvtlddlvgleelkealkealellslgikpgeivllyGppGtGKTtlaka
00498811   1/1  ----------------------------kPgkiigltGpsGsGKsTlarlLae.l.....gvividgddl
00470731   1/1  ----------------------arpltfddvvgqdeakeeleellagllgikkpkvillvGppGsGKTTl
00405881   1/1  ----------------------------gervglvGrpgaGKSTLlnaltglk.aivsgypgttldpnlg
00477011   1/1  ------eelrklldlidklrdlllsldlglpkvaivGrsgsGKSTLlnallGldvlpvgggpgtrrptel
00508671   1/1  ---------------------hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsg
00451571   1/1  -----------------------MsikkgeiiaivGppGsGKsTlaklLakll....glivldgddl...
00532471   1/1  ---------------------------pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvg
00439861   1/1  ----kleeveristgipeldellgGglpkgslilitGppGsGKTtlalqlaanlaknggkvlyisle...
00392701   1/1  ------------agarlaledlslgirpgknvlLvGppGvGKTtlaralagllgapfgrvda........
00513251   1/1  ---------------iellsdlslsipspevvllvGppGsGKstlakklaell....gfilidaddlr..
00406781   1/1  ------------aglrlllkdlslgippgknvllvGppGtGKTtlakalagelgvpfvrisa........
00432181   1/1  ----------------------slelkkglkvalvGrpgvGKStLlnallglkvaivsdypgttrdptlg
00499191   1/1  ---------------------------kgkiigitGpsGsGKsTlaklLaellgatvgdvd.........
00469161   1/1  -----------------------------llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgt
00517691   1/1  ---------------------lsfelkpglnvgivGhvgaGKSTLlnallgllgaivgdvlvdg......
00444381   1/1  -----------------asdelekllelrpvlledvigqeeakkalslalelplkrlelfgklddligrs
00515351   1/1  -------------------------mn.gklivltGppGsGKtTlaraLaerlglpvistddllreav..
00499331   1/1  ----------------------PslslkkgklivltGppGsGKtTlakaLaerl.....glpfidtddll
00489631   1/1  ---------------------------MkgklillvGppGsGKtTlaraLaellglpf..iridgddllr
00527261   1/1  -----------------npfilgpkvdledfigreeelkeleeal..pkivlltGprGsGKTtllkalak
00409841   1/1  ---------------------lslelkkglkvalvGrpgvGKSTLlnaLlgadlaivsdipgttrdpilg
00482551   1/1  -------everlstgipalDel.lgGglppgslvliaGppGsGKTtlalqlaanaalplelgklggkvly
00437901   1/1  ---------------------lslgirpgrillLyGppGvGKTtlakalakel..gapvieidaselrd.
00386741   1/1  ---------------lealkavllgirpgehllLvGppGtGKTtlaralagelgapfvrlda........
00394721   1/1  -----------------aleallealrrgpprnvlLvGppGvGKTtlakalakelaagsgpilldgvpv.
00509891   1/1  ------------------------------pkvigitGpsGsGKTTlanaLarllkarglkvavidrdpg
00476071   1/1  ----------------------------kgkiigltGpsGsGKsTlaklLaelglpvidtddltregvll
00437921   1/1  -----------------alerlllalkagklphlllvGppGvGKTtlaralarlllgsgggvdvieldas
00519581   1/1  ---------------------------kpkvilltGppGvGKttlarlLakllglpliidldalaellfg
00410321   1/1  ------------yggllllkdlslelkkglkilllGlngaGKTTllnrllggefp..eygptiginvg--
00420941   1/1  ---------------------lslgirpgkgvllyGppGtGKTtlakalagelgapfiridg........
00478081   1/1  ----------------------------gkvivltGppGsGKtTlarlLaellkplgggvvvi..dtddl
00420081   1/1  ------------------------smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPia--
00402371   1/1  -----------------------lrrrpgrnvllvGppGvGKTtlaralagllvrssgpilldgvpfvrl
00511381   1/1  ----------------------llllkpgglvlitGPtgsGKsttLlralnrleeagkgvilvkdaidtr
00495771   1/1  --------------------dilldilkgktvalvGpsGvGKStLlNaLlgellattgeipgdggdgrht
00401211   1/1  ------------------------elkrglnvgivGhvgaGKSTLlnaLlgllldtlkgelergitik--
00533151   1/1  ----------------------MsldikkgklivltGppGsGKtTlarlLaerl....glpfistddllr
00461621   1/1  ---------------------------mkgmiialtGppGsGKsTlaklLaerlglpfistddlyrevve
00472911   1/1  ------------------------mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglag
00482721   1/1  ----------------------------kgkiigltGpsGsGKsTlarlLaelglpvidtddlyrel...
00478391   1/1  ------------------------msikkgklilltGppGsGKtTlaralaerl....glpvidgddllr
00471271   1/1  -prailelesliksllekllellkrlslklkkglkvalvGrpgvGKStLlnallggdfaevgptpgtT--
00489391   1/1  -----------------------lsikkgklivltGppGsGKtTlakaLaerl.....glpvistddllr
00521551   1/1  ---------------------lslglrpgkgvlLvGppGtGKTtlaralagll..gapfvrlsaselvg.
00487061   1/1  --------------------------ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepv
00493171   1/1  ----------------------------mgklivllGpsGaGKsTlaklLaekl.....glivlsvgdtt
00410531   1/1  ----------------gelknlslelkkglkillvGlngvGKTtllkrlag...................
00367291   1/1  ----------vtlddvvgqeeakeallealelalkgldlflslglrpgrnvllyGppGtGKTtlaralan
00478131   1/1  ----------------------------kgkvivltGppGsGKtTlarlLaellkplglgvvvidg----
00496061   1/1  ----------------------------gklivltGppGsGKtTlaklLaerl.....glpvistddllr
00457851   1/1  ---------------------------PkgklivltGppGsGKtTlakaLaerl.....glpvistddll
00416171   1/1  ----diigqeeakka..llealslaartgenvllvGppGtGKttlaralakllprsgvpfvrvncsalte
00378621   1/1  -------------glklllrrlslllkkglkvllvGlpgvGKstllnrlag-------------------
00523461   1/1  -------------------------------akvalvGlpnvGKStLlnallgdk.aivsdipgitrd--
00470231   1/1  ----elaellsllierlllrdlllelkll.kvllvGdpnvGKStLlnrl---------------------
00477561   1/1  --------------------------kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr
00457881   1/1  ---------------------------mgklivltGppGsGKtTlaklLaerlglpvidtddllrele..
00414001   1/1  -------------------rrlllelkmllrvgivGlpNvGKSTLfnaLtgakvaivanypf--------
00488191   1/1  -----------------fllsllrrlslllkrllkvalvGlpgvGKStLlnallgakflakvsptpgt--
00482661   1/1  ------------------------kkvaivllsnyalsislddlllildlykevqvaydnfykvdesdia
00477721   1/1  ---------------------------kpklilltGppGsGKttlaraLaeel....glpfidtddll..


                         -         -         *         -         -         -         -:140
query           TPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPLARKEERKALEEALSLLEYVG
00379581   1/1  talslaelrrrgigyvfqdpalfpgltvrenlalglllllllllllllllllalskae..arervlelle
00475891   1/1  dilglsllellrrgigyvfqdpalfpgltvlenlllgll...............llglalkeaalralll
00440861   1/1  tLlnaLlgllkpdegvilvggkgvTrdivlytledgvkltliDtpGlgdtklsdeeklilkyleeadlvl
00361211   1/1  ldgleisalslaerlragigyvfqdlalfpeltvlenlalg............................r
00458601   1/1  spqelrrlggvvvqevllffltllenlllglallll.llvlllllllllllllaakeaalralllllllg
00378981   1/1  slaelllllrrgigyvfqdpalfpgltvrenlalgll...............laglskaeaaaraaelle
00500441   1/1  dildlsl...lrrgigyvfqdpalfpgltvlenlllgll...............llglslaeaaeralel
00475991   1/1  Geilldgkdildlslael..rgigyvfqqdallpsltvlenlllglllagelll.........lllaake
00390411   1/1  gadkasvelvfeldggllallrllslsggeklrvalakallgnpeillngepvnhldlrelllnllrrrg
00422801   1/1  lagllkptsGeilldgldilalslaelrr.rigyvfqdpalfp.ltvrenlalgllla...........l
00482201   1/1  slkel..rgigyvvqqdallpsltvlenl..........llgllllgllllllaakeaalralllllllg
00490801   1/1  vGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll..........
00482261   1/1  slael..rgigyvfqqdallpsltvlenlllgllllgellll.........llaakeaalralllllllg
00510251   1/1  lvGpnGsGKSTLlkllagllkptsGeilidgkditglspqelrrlgglvlqdvllffltll.........
00420701   1/1  llslaellalrrgigyvfqdpalfpgltvrenlalglllag...............lskaeararalell
00530591   1/1  kptsGeilldgkditdlslkel..rgigyvvqqdallpsltvlenl..........llgllllgllllll
00502741   1/1  slael..rgigyvfqqlallpsltvlenlalgll...............llglskaeaaaraaellellg
00404101   1/1  slael.rrgigyvfqdpalfpgltvrenlalgll....................kaeararalellellg
00425571   1/1  sl...lrrrigyvfqdpalfpgltvrenlalgllll...............glskaeaaaralellellg
00367901   1/1  lkgllllprstvatvelifdllgllliirrlilrdgsgeilidgkdislldlrelrr.ligyvpqdpalf
00466971   1/1  ilglslaelllllrrgigyvfqdpalfpgltvlenlllgl...........lllglllllaakeaalrle
00466931   1/1  lalspeellrllrrrigyvfqepalfpgltveenlllglllrlllelllgrlelllllllllellallld
00436071   1/1  .....lrrgigyvfqdpalfpgltvlenlalgllllgll.................ealaralellellg
00372301   1/1  vdgedlr...........igyvfq..............................................
00509431   1/1  liflgslirsgadrasvelvfdlsdglyllerselilrrlilkpgsgeilingkdislldlrelrr.lig
00485451   1/1  vlvigldifrlsarelrkrig...vfqdpallphltvpenldlglll.....................ei
00498251   1/1  Lalrllagllkpgggvvyidgeesldll....rarrlgvvlqelllfpeltveenl..............
00495371   1/1  vdgldltglspa...rggiglvfqteallppltvrenlealgldlrglld..................re
00468691   1/1  vglvGpnGaGKttLlkllagllkpdsgeilvdGedlrelre...lrrrigyvfqdpalfpeltvlenlal
00469451   1/1  dvlylsleesleqlrrrigyvfqdpalfp........................................a
00496111   1/1  aeelrerr.rrigyvfqepalfpeltvlenlalgll..................................
00468601   1/1  aaae..rlgigavpqdvplfpsltvldnlala.................rdlleaakaagydvvlidtag
00424961   1/1  pdsgeilldgvdigersrevtelleelrrviglvfqdpplfprltvaenialga...............e
00485931   1/1  .......rrigavpqlpvlfprltvlenlalg......................gadlaeraeellellg
00500611   1/1  illggkvlyisleeslrrrrigmvfqelgldpdltv................................ar
00436511   1/1  GervglvGpsGaGKtTLlkllagllkpdsGeilvdgligerlrevlelirelelaelrrrigyvfqdpal
00448931   1/1  a....areqlgivfqdp....gltvlenlalg........................eleararellellg
00367481   1/1  asggilvpgedalll.......................................................
00379601   1/1  llsldleellalasriavlagrdiserrlpldgallpdgsrvrvrlsplptllggeslvirklpkliltl
00488521   1/1  i................ggkvlyvdqeeslfp.ltvlenlalg..........................g
00503371   1/1  iylsdlirrgagiayveqefdlfdgltvlenvllglgdeliirrrilrdgrseyllnglgvslkeliell
00422141   1/1  deeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklreviltledl
00371631   1/1  gklalddvslsvkkpeiigiaGpsGsGKSTlarlLagllapesgglkvlligtDifylpa..eqlkrigl
00437981   1/1  kdi.........rrgiglvfqliglfphltvlelvalgl..................ggilveevrellk
00475371   1/1  sarellg........................................................llgellg
00495031   1/1  gkvlyiglelt.lsperlrlraqsl.......................................gldlde
00464791   1/1  ervglvGpnGaGKTtLlkllagllkpdsgeivvygligerpre...........vrellglllelgvlf.
00381441   1/1  gevdgvdltfls.....reeigyvfqepallpdltvlenlylg...............lllalllaleeg
00457311   1/1  klsreelrklrrrigmvfqdpalflnpgltvrenlaeplrll.klgkk......................
00532531   1/1  ggfyakaigllrrkigyvfq...lfpfltvlenvalgld...glvdeedl..............eraenl
00414121   1/1  dgqll.edlgvlavrlgigyvpqtlglfpaltvlellalall............................
00387201   1/1  vreyelGeilldgrdlyrlsleeallllfldeileidglllvelregigyvfqdpalfpeltvlenlalg
00489571   1/1  ......................................................................
00490731   1/1  aadellgvlaee........................................................lg
00478411   1/1  glkd....gigmvfqdpalfplltvrengvalglllag...............lskaeieervdlllelv
00477971   1/1  pprpgevdgvgyvfqsrelfpeltvagnfleg...............aevrgnlygtsrerveellea.g
00480471   1/1  lldgkdltlvdtpgiargrlklllearraaigivfqdvdllltltvaenlllg.....ldllllellkel
00434401   1/1  paaelllreglgidfqlpdal.....................................drellreevlel
00515531   1/1  gvklqlwDtgGqerfrslwilyfedadaiifvvdlsdrdsflelrrwigrlfqdlnlfpsltvlenl...
00462761   1/1  r.......lglliglvfqdpdllpfltvlenvllpllaagliv....................ivdgtll
00368501   1/1  akll..gapfiridgseltekdyvGesvearlrelfeeaigyvfqdpalfpg.tvlenlalgllvselig
00512891   1/1  ...rsarrgigyvfq........tveellgllaelvgle...........................vrge
00379961   1/1  lldpkdlrellragiplvflnfaalpasllesel....................................
00437941   1/1  vlgidaselld...........................................................
00533501   1/1  tp.....lgrgigyvfqdpalfpgltvrenlelllvfadrygvlrglikpalae........gvsvildr
00484101   1/1  dldellg..igylfqdvgllpvltvrenlal...............llrglpgysaeeleralellelag
00493431   1/1  pgevr...gigyvfqsgalfphlivagnlleg............aevhgllygtskerveeale......
00475521   1/1  leplrr...digmvfqdpalfplltvrenvilgllelag...........lskaealarvdellelvgld
00464411   1/1  plge....ligevfqdgilfpdltvlenvalgry..............gllglikealaegvivildrvg
00426051   1/1  ggesglllrdlrrl.iglvfqdpilfpgltvglllffldnidlgllirg..................dee
00475381   1/1  srdllgllreglirigyvfqdyalfprltvlenvllgll...............................
00503741   1/1  llagllkpkfgeillfg............................kvvyvnvselldlkellrll.....
00496571   1/1  eplgelir...glvfqdpllldeltvlenlalgrylhl.glilaalaagvgv.............vldrv
00468951   1/1  GsGKTtlalqlaanla.klggkvlyid...teesldqlrarrlgldlddllllpaltveellala.....
00510561   1/1  KTtlalqlaanlaaqggkvlyisteesleql...rarrlgldldrlllldaltv................
00487021   1/1  a..........gevfqdyalfphltvlelldnvllgleirgllk...............aerlervevll
00478441   1/1  ...elrgrdilmvfqppalfpllevrglniaevlelag............lskaealkrvdlvlelvgld
00480441   1/1  epregevlgvdyvfvdrelfeelivagnlled............aivhgllygtskerieealda....g
00515511   1/1  gvklqlwDtgGqerfrslwllyfegadaiifvvdlsdgdsllalrrwigrlfqslnllesllvlenlanv
00498531   1/1  pGsGKTtlalqlaanlaklggkvlyisteesleql.rarrlgld..ldellllpaltveellala.....
00356411   1/1  kltlwDtgGqesfrklwilyfegadaiifvvdasdrdsflnldkwrnrlgevlqllelilnltvlenvpi
00368571   1/1  hllivGptGsGKStllrllaglllpdggrviv..iDpkge....yaglarglgvvildpgdgrsvrlnpl
00379261   1/1  LvGppGvGKTtlaralAkllgapfvevdaselteggyvgedlekr.........irelfqearllvfltv
00513761   1/1  ranlpeqlgi....dirdlidletvme.lglgpngalvfaleellttldillealell.eedydyiliDt
00480251   1/1  psapeqlgi.lgellg............................vpvvgvltgldlagalrealell...
00404191   1/1  lanelkkrggrvlyvsa.....................................................
00498811   1/1  trelvaggglliglifqdfglfelldrellielllenlalglal............egvildalrrrlle
00470731   1/1  aralakel..gagfilidgddlrekavgeleklgr...dlfqvaregglvpdilfideidall....rkg
00405881   1/1  vveldd.................................grqlvlvDtpGlielaslgeglvrqaleale
00477011   1/1  rlsetpgltvlvvflelgerldllglvfqdfsllpelielenralagpia.......gisrdairleiel
00508671   1/1  vvlldgddlraglsiglilsdedraalrrr.lgevfqelllagrlvvldgtalglel.............
00451571   1/1  .....lreaiglvtqdgelllelid.egilvpdeiv...............iellrealeeldadgvild
00532471   1/1  elggaalldivde..grliglvfqdldllpllevlellaa..............................
00439861   1/1  esreqlleraerlgldleellllgllsiliad......................................
00392701   1/1  ....................................................................sd
00513251   1/1  ......................................................................
00406781   1/1  ......................................................................
00432181   1/1  vveldgrkl.............................................................
00499191   1/1  .................gllvgvvfqddfylllpalevlengaflldlllpdaldrelllelll..alve
00469161   1/1  plgelirelllegfqdlilvpdllvlellaan...................raglrelikellaagkgvi
00517691   1/1  .........................................................gtlllllgllsfl
00444381   1/1  pairrllellgarpgenvlLvGppGtGKTtlakalakll..gvpfiridgselte...............
00515351   1/1  .......pggtdigelfqdyllfpfltvdeni......................rglllealeellaag.
00499331   1/1  repvigagtdigevfqdlllaggllvddev.............................rrlllealdel
00489631   1/1  ellgellgrgigfgfqqgdlledatvlenlalllldeidka.............................
00527261   1/1  el..gkpviyidlselsskgyvdleellrela....................................ee
00409841   1/1  v.....................................................................
00482551   1/1  isteeafsperlreralslgldleelldrllvidat..................................
00437901   1/1  ......................................................................
00386741   1/1  ......................................................................
00394721   1/1  ....................................................................vr
00509891   1/1  rld............................................ldeplgvdrerlrrvgelallla
00476071   1/1  ggpllerirel.lgegyllfdealdrellaallfglelegal............................
00437921   1/1  dlrgvddlreligevlqalglllgg.............................................
00519581   1/1  dvgglvvdli............................................................
00410321   1/1  ----------------------------------------------------------------------
00420941   1/1  ......................................................................
00478081   1/1  rreairelllgldlleilf...................................................
00420081   1/1  ----------------------------------------------------------------------
00402371   1/1  daselle...............................................................
00511381   1/1  l.gielvvsriglvleavglffaldllelll.......................................
00495771   1/1  Trd-------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00533151   1/1  elv..pggldigevfqda.leaglllfddefrglller..............................le
00461621   1/1  rgtelg.........klikdyfdpgalvpdllirlllerllfldeg...................ggfll
00472911   1/1  eggkpl................................................................
00482721   1/1  ...........................vaggtplgerirellgegyllpdealfrallaellfgdllala
00478391   1/1  elvgeggrlgrd.lfdedrllfrellideidl......................................
00471271   1/1  ----------------------------------------------------------------------
00489391   1/1  eavpg.gtdlgelfqdlllegellfideiaelllealae...............................
00521551   1/1  .......kyvgelegglrql..................................................
00487061   1/1  dywaavgggdllrlirelllrlg..........fgepdafdnellgellealleg...............
00493171   1/1  repregevdgvdyvfvsgelfkelidagelledaiv----------------------------------
00410531   1/1  .....................................................gefvdygptigvnfktv
00367291   1/1  el...gapfirvda........................................................
00478131   1/1  ----------------------------------------------------------------------
00496061   1/1  eevepggtdlgeifqalllagel.lfddevlgll.....................rerldelielllagg
00457851   1/1  reavpg.gtrlgeviqdlfllggllffdeldel..........................lkerieellaa
00416171   1/1  .............................................................dlleselfg
00378621   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00477561   1/1  ..................................................................alif
00457881   1/1  .......pdgtelgellqdlllag......................gllpdaivrdlllellee------
00414001   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00482661   1/1  yqyallakedenaaaflksnrqkklvrdladrviaeerlellekiieellrirldklledldeiveelpp
00477721   1/1  ..relvgegielilelfdrarfrkllielldellaaggvvldlgrtlllrralrellreldlvvfldapl


                         +         -         -         -         -         *         -:210
query           LLHRKDELARNLPYGEQRKLEIARALALKPKLLLLDEPAAGMNPKETEALQEFILKIRSEMGLTILLIEH
00379581   1/1  lvgldtlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelake.gltvll
00475891   1/1  llllgletlldrlvseLSgGqrqrvalarallldpkllllDEPtsgLDpetraellellrelake.gltv
00440861   1/1  lviddglteldlellkllkelgkpvilvlnkiDllkkeelekllkslnkelglkelrrgigyvfqdpnlf
00361211   1/1  arellerlglail.drlpgeLSgGqqqrvaiaralaldpdllllDeptsalssrssendpetvaellell
00458601   1/1  ledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvtH
00378981   1/1  llglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvll
00500441   1/1  llllgledlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelakelgltv
00475991   1/1  aalralllllllgletlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrel
00390411   1/1  iglvpqehdlfplltvaenialldelaglpkygnylsllkeklkelnallkelelqlkelarllellegl
00422801   1/1  lllglskaeararalellellplgldtlldrlvgeLSgGqrqrvalArallldpdllllDEptsgLDpet
00482201   1/1  letlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellellrelak..gltvllvth
00490801   1/1  ................lllaakeaalralllllllgletlldrrpseLSgGqrqRvalArallldpdlll
00482261   1/1  letlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelak..gltvllvth
00510251   1/1  .................lllaakeaalraellllllgletlldrrpseLSgGqrqRvalArallldpdll
00420701   1/1  ellglddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvl
00530591   1/1  aakeaalralllllllgletlldrlpseLSgGqrqrvalArallldpkllllDEPtsgLDpetraellel
00502741   1/1  ledlldrlpseLSgGqrqrvalArallldpdllllDEPtsgLDpetraellellrelake.gltvllvth
00404101   1/1  ldelldrlvgeLSgGqrqrvalarallllleelsldpdllllDEPtsglDpetraellellrelake.gl
00425571   1/1  lddlldrlvgeLSgGqrqrvalarallldpdllllDEptsgLDpetraellellrelakelgltvllvth
00367901   1/1  pqltvlenlllglelrrklldellgllellalleellklleellkelevleaalaallkeeieeraeell
00466971   1/1  llllllgletlldrlvseLSgGqrqrvalarallldpdllllDEPtsgLDpetraellellrelake.gl
00466931   1/1  lllllllllllllllllllvlllllllllvlllllllalllllalkeaallleelllllglgdlldrpvs
00436071   1/1  lgdl.drlvseLSgGqrqrvalarallldpdllllDEptsglDpetralllellrelaeelgltvllvth
00372301   1/1  ...llervgledlldrlpstlsgGqrqrvai.ralatepsllLlDEptsgldpelraalaeallellael
00509431   1/1  yvpqdpnllfqltvlenlllgpeerrelldellgl....ellsleealaraeealeelnallkeleeele
00485451   1/1  lervlellelvgldvvlldtyphelSgGqrqRvaiaralaldpdvlllDEptsglDpetralelldllrt
00498251   1/1  ................................drlprllsggqrqrvvidsalalrpkllllDEPtsgld
00495371   1/1  rviellelvgleelldrlprelsggnqrqrvvia.alallpkllllDEptsaldvslraeilrlLkrlak
00468691   1/1  gallag...............................lglaeyldelgkdLSgGqrqrvalAr.....pv
00469451   1/1  eellelvgledlldrlpgelSgGqrq..aiara.ardpdllllDeptsalrgsenDpetraeilrlLkel
00496111   1/1  .......drlpgeldlSgglqrqrvaia...agdpdllllDeptsalrslgndpelraellrllkrl.ke
00468601   1/1  lld.ldrlvgelsggqkqrvaiarala.apevllldeptsgldalae..llelleel....gltvlvvtK
00424961   1/1  yfrdegadvllladsllrlagalrevlgrlgrelSgGqkqrvaiarallleragnleggGsiTalatvlv
00485931   1/1  legfdvvliDtagrgrrvgelsggqkqrvaiarallllldpelllldEptsglda......lrlllellk
00500611   1/1  erviellelvgllelldrlprelkrsggqrqrvviDaralllrpel..lDEptsaldvslraeilrlLkr
00436511   1/1  pallrllalfpaltvaenlrfglglavllllds.atrlaqakreisalarellervglpgdlftllsrld
00448931   1/1  ledydvvliDtagrlrlpselsggqkqrvaiaralaaplppevllldeptsglda..lrellellrel..
00367481   1/1  .....rvdeiltrvglsdlldrgls.lsggerqrvalaralatdpslllLDEptsgldpedgaalaeall
00379601   1/1  edllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppdegiitiegpdel..
00488521   1/1  edveellerlgl.dlldrlphqlsggqrqrvaiaralaeelkpdllvlDeitalfraelegrptsaldvs
00503371   1/1  ldlsggelnrvalllqgevdlllldepterldfldelagleeykgnyeellklleeleellkelekrlel
00422141   1/1  glsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpdegriltiedp.............
00371631   1/1  lfq.kglpealdveellellldlke...................................gledilvpvl
00437981   1/1  el...............lsgGqkqrvaiaralagdpkvlllDEpt.aldpdaqnaLlklleelak..gvt
00475371   1/1  ldvlvgarggdlsgglrqr..larallgdpdvlliDepgrgldpellallaelldllrelradlgllvvd
00495031   1/1  llerllvidllelvgllelldrlprelsggqrqrvviDalalllrpell..DeptsaldvqlvaeilrlL
00464791   1/1  .................................aaellervglvaatadeppgelsggqrqrlaiArala
00381441   1/1  kivildgdreraeellellgldadlviilpasleellerldrrggelsggqkqRvala------------
00457311   1/1  llepvglpevldryphelsgGqrQRv...ralaldpdllilDeptsalgqpdpelr.elldllifldadl
00532531   1/1  lalvgleeipnrypselsgGqqqrv...........illldEPtsgLdpvsr..................
00414121   1/1  ...............lredpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldl
00387201   1/1  l---------------------------------------------------------------------
00489571   1/1  ................lallelrntteagaasgsrdkgllgklkpetraelldllre....egttilvvt
00490731   1/1  ldvllgarggdlsgglrqr..larallgdydvliiDtp.gtldvllelallellkellaelgadvvllvv
00478411   1/1  glddlldrypdelsggqrqrvaiaralalepelllldeptsaldplavvellelllglneeldiilalel
00477971   1/1  ldvlldidpqglsggqkqrlalaralilppsllrgldep.ealdarle.raleellelae..gfdvvivn
00480471   1/1  kydpvilllnkidllddrllrraeaeerieellelvglsallg---------------------------
00434401   1/1  lglgevvivdvydlsggerqr...aralasgpdvlilDgptlgldv.............lldlpdlvifv
00515531   1/1  ....anvpillvlnKiDlleakera.....eellellglgdlldklpselsgGqkqrvalaral------
00462761   1/1  lvglrealrkllgllsgGqkqrvadlvvlldadpevllaReptrgldpeteeeleellerleereplyga
00368501   1/1  appgyvggdlggllteavlealriklvegelgfrelerevlldlplhdasviallgggrelrdgellkal
00512891   1/1  leellktlikelsggekqrvalarallakpdvlllDEid.gldpdvleallelleelk.rsgvtvilttn
00379961   1/1  ................lsggerqrvalaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleeg
00437941   1/1  .................pselsggerqrvliaralladpkvlllDEi.daldpeaqnaLlklleelpk..
00533501   1/1  vglsdlaydgfprllsgggrqrvalaralvvkpdlvilldeplevldeRlrkrgrlelrelds.eevlek
00484101   1/1  fdvilieGllelalplilelrelsdgqiqrvaparallrdpllllldedtvvldkvdlasildllle---
00493431   1/1  .kgllvlldrdlsggqqlrvalaralvvfildpslelldeRlsgrdadtreeirkrlkrlleelgpliey
00475521   1/1  dellldrlp......sggqqqeilrvaiallilpvllgralallpelllldeptsaldpd----------
00464411   1/1  lsdla..ypgflsggeqqrvaiarallpkpdlvllldepteeldeRllkRg.....rllekleyikkrle
00426051   1/1  leaalelaglprvielllegldtlaggggvvlsGgqrqrvalar.....pdlllfldeptselleRllkr
00475381   1/1  ........llgglvvildggvrqrlalarallldpdvllldeplllldaalr...........dlpdlvi
00503741   1/1  .......................lealglpppyqlsggerlrvalaeallalgkpdllilDEitnlldpe
00496571   1/1  glsdlaygfprtlsglgqrqrvalarallkpdlvifldeppteeldeRlrkrl.........rlgdteev
00468951   1/1  .........................................erllsggkpqlvviDsltalrpallllde
00510561   1/1  ..............................eellalaerllsggkvdlvviDsltalapalelsllldep
00487021   1/1  ervgl..lldrippalsgGqgqrvildrallselayqpdvllldeplsgldaklreelrdllrellpe.g
00478441   1/1  ......drypyelsggerqrvailr..vllpklllpdepgrnldvlievavlnlilkl...lgidallel
00480441   1/1  lgvlldgfprglsqaqalrlaldlvllldpslevlleRllgrgddteevirkrlerlapeleyyeelgla
00515511   1/1  pi...............llvlnKiDlleaklvllllvglfdlldglpselsggqkqrval----------
00498531   1/1  .........................................erllsggkpdlvviDsltalapsllllde
00356411   1/1  ................ilvlNKiDlleekiveellellgleykgdrdpeelsggqkqrvalaralakdp-
00368571   1/1  ...aliddeedaaellralvsemgrgeddfftpaarallralilalaeepeptldellellselg.....
00379261   1/1  lenirldaseylekrvvsrligappgyvgyglggllteavrrlpysvllldelekahrpirvlllsaslv
00513761   1/1  pGglelrallallla........iaral.aadeillvddptsgldaetqleilelllelllklgipiilv
00480251   1/1  .llegydvvliDtagglqrglllalaladlllvllldepllvldatagtellelakgllealgldgvvlt
00404191   1/1  ...........................delvsklsgglqeqrvaiafalarkpdllllDEidalgldpel
00498811   1/1  lldll...gldvvilegplllsgglrqrpdlvifldappevlleRllkRggldeetiekrlelylelapl
00470731   1/1  pd.vildgagrtpeqlealldllee.........lgrpvvviilttnrevlldral.rRpgrllldep..
00405881   1/1  radvillvvdasdplldqpvellsggekqrlalarallgkpvilvlNKiDep........tneldlelle
00477011   1/1  pglp.dltlvDtPGlgsva..vvdqlsggqkqrvalarallknpdtlillvedand..ldtesdalellk
00508671   1/1  ...rdelrellkeaglpllvvfldaplevlleRdrrglypeelsgglkqrvaiarplelaaepdlv----
00451571   1/1  gfprllgqaell..lsggkadlvifldaplevlleRllkrddekilkrleeqkqrvaiarallkkpail-
00532471   1/1  ........rleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdllesl
00439861   1/1  ...........plglsgeellrvllalalelkpdlliiDeltalldaervrelrellralkrlakelgvt
00392701   1/1  llg...kyvgelsgglrqr..larallakpsvlllDEidklapkrsptsgldvelrrrvlnaLlrllegl
00513251   1/1  ..............gqkqrvalleaalkegylvvvDet..gldraqrlellelardlgrpv.lviflats
00406781   1/1  .....sellgkyvgelsgglrqrlalara..adpgvlllDEidalldarsgsgsggdsssrrvlnaLlrl
00432181   1/1  .....vliDtpGleefa.......sggekqrvalalallreadvlllvvdadeptsfldle....lle--
00499191   1/1  glvvlldryprllsggqrqrvaia.....dpdvlildgptllldpe...........lrpladlviflda
00469161   1/1  ldrfplsrlayqlsggerqrlaidlegalllerllldepfpdlvifldaspeelleRllkRgreergrdl
00517691   1/1  lalvldslplerergitidvalarllldgrkilllDtP..Ghed.....fvkevlralrladgallvvda
00444381   1/1  ...kelvGe.......................................................segail
00515351   1/1  kvvild.......glsggllqrvallrallrpdlvifldapleelleRllkRddseeeile---------
00499331   1/1  llaggkvvildgfpggllqrealrrllprpdlvilldappeelleRllkrgrldgreddslellekrler
00489631   1/1  ...ledggvvlldgfdrsqlqrlailrallddppdlvvfldapleellerllkRdgrteeeilerlarle
00527261   1/1  lgellellkkllkklsel..lglsilglelilglsggdleelleelaellkklgkpvililDEiqsll.d
00409841   1/1  ........................vlldgrdllllDtPGlidfaseptnlldleiieallraleeadvvl
00482551   1/1  .........dlldllellerlrrllsegkvdlvviDslallarael..ldepllgldarelrellrlLkr
00437901   1/1  .vddlsgyvgelsggeklrellaealteavlkgkpsvlllDEi.daldpdvlnallklldglrdlsgvli
00386741   1/1  .........selsggeklrgllarala.kpgvlllDEida.ldpdvqeallelleegeltivggglltel
00394721   1/1  ldlsellsvsdlvgelegglrglltealala.kpsvlflDEidrlldardsesslevlnaLlrlledgnv
00509891   1/1  gggl...calvaddlagaleel.laralaggpdviliEgagllplp........liellrdlldlvvlvv
00476071   1/1  ...........ldglvygvlqdrllerllaagpdvlildgpl.lldvellplpdlviflda---------
00437921   1/1  ..............................kpdvlllDEi.drldpdaqnallklleel..pagvtlilt
00519581   1/1  ...............dleaverhlldiaeellengeilildeptvgldskd...ildelakilkevnfel
00410321   1/1  ----------------------------------------------------------------------
00420941   1/1  .....sellgkyvgelsgglrqllalara..akpsilllDEidklapkrsptsaldadvrrevlnaLlrl
00478081   1/1  .......eglllsdefrelleealalladgdvvilDgfgrlldarq...lleelllllleepppdlvifl
00420081   1/1  ----------------------------------------------------------------------
00402371   1/1  ....fgkyvgafegglrqllglaraa..kpgvlflDEidsllgarggsgvdpevqnaLlrlleegnvrvi
00511381   1/1  ............................qdpdviliDE.aqfldp....evvevllelad.tgilvlvtg
00495771   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00533151   1/1  ellargpvvildgfpggllqrealrrlllrpdlvifld--------------------------------
00461621   1/1  dgfprtleqaeals....kpavlsggrkqrlalaralavdpe.lildgrllgr.............rllp
00472911   1/1  ..gllfedaleagfr....qrladlirallakgkvvild..gtglsreareellellkelg..pvlvifl
00482721   1/1  lldgvvydrlrdellaelsggqgdvliiegalllepgllplpdlvifldappevlleR..llkRg..gds
00478391   1/1  ..........................llakgkvvildgtn..lsealdealrrllr.....pdlviflda
00471271   1/1  ----------------------------------------------------------------------
00489391   1/1  ...........................aegkvvildgtg..ldieqrealrelllel.prpdlvifldad
00521551   1/1  .....................lalaraanpgvlflDEidklapkrsptsglddvsrrrvlnaLlrllegl
00487061   1/1  ........................gkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagy
00493171   1/1  ----------------------------------------------------------------------
00410531   1/1  evdgvklviwDtaGqerfrsllarylrgadgillvvdatdglsfeevaklleellglaglegvpiilvgn
00367291   1/1  ........selle..klvg............egegrlrgalaealradpgvlflDEidalagkrgsgtsr
00478131   1/1  ----------------------------------------------------------------------
00496061   1/1  .vvildgfpldlegalllrealarallpdl.vifldap--------------------------------
00457851   1/1  g.gvildgfpldlegaealreallragplpdlviflda--------------------------------
00416171   1/1  h......ekgafgggekqrlgllrla..dggvlflDEidkl.....dpdvqnaLlrvleegeltrl----
00378621   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00477561   1/1  qd.eldlfdedreegfrvpeelvrellkellarllaeggdvvilDgtnl......tleqrealrrllkel
00457881   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00482661   1/1  vlfddlvgqeeakeallenlklflkgpellldlglpkgrgllLyGPpGtGKTtlakalanel...ggpvi
00477721   1/1  eelleRllkR............ggrfdllielplleelkeilrellplykeladlv--------------


                         -         -         -         +         -         -         -:280
query           DMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYLGRGAAGGAA---------------------
00379581   1/1  vthdldealrladrilvlddGrivelgtpeellenpgllglllgee------------------------
00475891   1/1  llvthdldealrladrilvlddGrivelgtpeellenpgllaa---------------------------
00440861   1/1  pglvvlisaltgegldeltvrenlalglrlrg.......-------------------------------
00361211   1/1  kelakelgvtvilvthdldlldsallrpgkrpllsdlrgsgeieql------------------------
00458601   1/1  dldealrladrilvlddGriveegtpeellenplllytllllgalplldeg-------------------
00378981   1/1  vthdlsealrladrilvlddGrivelgtpeell-------------------------------------
00500441   1/1  llvthdlsealrladrilvlddGrivelgtpee-------------------------------------
00475991   1/1  ake.gltvllvtHdlsealrladrilvlddGriveegtpeel----------------------------
00390411   1/1  keeaekakalleelkeleklllay----------------------------------------------
00422801   1/1  raellellrelak..gltvllvthdlsl------------------------------------------
00482201   1/1  dlsea.rladrilvlddGrivelgtpeellenpgllytllllgeel------------------------
00490801   1/1  LDEPtsgLDpetraellellrelake.gktvllvtHdlse------------------------------
00482261   1/1  dlseal.ladrilvlddGrivelgtpeellenpgllytllllsslpg-----------------------
00510251   1/1  llDEPtsgLDpetraellellrelake.gktvllvtHdls------------------------------
00420701   1/1  lvthdlsealrladrilvlddGrivelgtpeel-------------------------------------
00530591   1/1  lrelak..gltvllvtHdlseal.ladrilvlddGriveegtpee-------------------------
00502741   1/1  dldealrladrilvlddGrivelgtpeellenpgllytllllgslpg-----------------------
00404101   1/1  tvllvthdldealrladrilvlddGrivelgtpeellenpl-----------------------------
00425571   1/1  dlsealaladrilvlddGrivelgtpeellenp-------------------------------------
00367901   1/1  ellglgglldrpvstLSgGekqrvalar------------------------------------------
00466971   1/1  tvllvthdldealrladrilvlddGrive-----------------------------------------
00466931   1/1  tLSGGerqrvalaralalallllsdppl------------------------------------------
00436071   1/1  dldlalaladrivvld------------------------------------------------------
00372301   1/1  gatvlfvtHdlelaalladrvvvlndgrivavgt------------------------------------
00509431   1/1  ligplldglellvglnglldrplselSgGekqrlalaralalael-------------------------
00485451   1/1  dldkelgrtiilvthdlreae..adrilvlrkgdivelg-------------------------------
00498251   1/1  plsarellellrrllrlakelgvtvllvthdldea-----------------------------------
00495371   1/1  elgvtvllvthdleeveeladrvavlaggrive-------------------------------------
00468691   1/1  lLllDEptsgldalr.e.ilellrellkelgytv------------------------------------
00469451   1/1  akelgvtvilvtH........Asdrvlvlrdgrivev---------------------------------
00496111   1/1  lgvtvilvthdleeaedladsgriavladgrivlegdlaelglrra------------------------
00468601   1/1  lDgtakgghdlslalrladrilvlgvGeivedgtpfell-------------------------------
00424961   1/1  eggsdpdllllDeptsalDgeivlsllla-----------------------------------------
00485931   1/1  elgltvlvvthddgtakggaalslaleladrilvlgdG--------------------------------
00500611   1/1  lakelgvtvllvthdlreveeladkrdrvvvlr-------------------------------------
00436511   1/1  eragnlSgGqr-----------------------------------------------------------
00448931   1/1  ..gltvlvvthlDllakggadlslaleladrilvlgdGe-------------------------------
00367481   1/1  ellaellgatvlvvtHdlelaalaadrivvln.grvvadgtpe---------------------------
00379601   1/1  .....lrnkigyvfQdpvlfp.ltvren.....-------------------------------------
00488521   1/1  llrellrlLkrlakelgvtvllvthdldevarla------------------------------------
00503371   1/1  lekeleeleellerlealekaleeleerlke---------------------------------------
00422141   1/1  ieyvfqspnlfpl...........................------------------------------
00371631   1/1  sggqkqrlalaralvedpdvlilDgptalldpltr.ell-------------------------------
00437981   1/1  vilathdlsellpallsrcqvirfpplseeelle------------------------------------
00475371   1/1  athdldavlkaadrilvldlg.givlnkldlvakggaalelae---------------------------
00495031   1/1  krlakelgvtvilvthdlrevegrleladrvvv-------------------------------------
00464791   1/1  ddqgkpvllllDEptsgldal..r----------------------------------------------
00381441   1/1  ----------------------------------------------------------------------
00457311   1/1  gltlirlitrdlgeagrsadrvl....griveq-------------------------------------
00532531   1/1  ..........leladriyvllsGrivesgtteellt----------------------------------
00414121   1/1  lkelaeqlgltvlivlnKiDllselthdlellre------------------------------------
00387201   1/1  ----------------------------------------------------------------------
00489571   1/1  h.ldeaer.aDrvavldd......Gtpeellarpanpyvrel----------------------------
00490731   1/1  datlgleaadrilvlleglgvpgvvlNkldlvaeggaalelle---------------------------
00478411   1/1  lllde-----------------------------------------------------------------
00477971   1/1  hdleealelldrilvll-----------------------------------------------------
00480471   1/1  ----------------------------------------------------------------------
00434401   1/1  dhdlevalerrlkrlg------------------------------------------------------
00515531   1/1  ----------------------------------------------------------------------
00462761   1/1  diviithdls.ieevadr----------------------------------------------------
00368501   1/1  keaeaeellellglkdlllrkpsqlSgGqkqRval-----------------------------------
00512891   1/1  dldel.eladriallrrgrivelgplse------------------------------------------
00379961   1/1  evtieragitlllpagvtvi--------------------------------------------------
00437941   1/1  gvtvilttnrleeldpallsRfdviefpppdeee------------------------------------
00533501   1/1  rlehylellekad.rvvvidag.....gslee--------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00493431   1/1  dyvivnddleealeelldiivvlllglilqpgslle----------------------------------
00475521   1/1  ----------------------------------------------------------------------
00464411   1/1  hylelaepykddvvvidan.....gsieevveeilk----------------------------------
00426051   1/1  ltrpgldadteeellell----------------------------------------------------
00475381   1/1  fldadpeelleRllkRg..re-------------------------------------------------
00503741   1/1  tlspdvlelLlrlleegkltdkllgltliltthdldllerladr--------------------------
00496571   1/1  lehrleraeeladrl-------------------------------------------------------
00468951   1/1  ptgellgldvrllsellrllkr------------------------------------------------
00510561   1/1  tsgldasllreilrllkrlake------------------------------------------------
00487021   1/1  ilpdlvifldadpeell...eR..llkRgresergepldlle----------------------------
00478441   1/1  vdrl------------------------------------------------------------------
00480441   1/1  dvvivnddleealelllaillall----------------------------------------------
00515511   1/1  ----------------------------------------------------------------------
00498531   1/1  pgrvtqgldarllreilrllkr------------------------------------------------
00356411   1/1  ----------------------------------------------------------------------
00368571   1/1  ..lrdladrleklvagglagllega---------------------------------------------
00379261   1/1  lllgglglpevgelllellddvgltdllgrtvdfkntiiilt----------------------------
00513761   1/1  lnKlDllseeglelvlelleellellpilllgvgpkdl--------------------------------
00480251   1/1  kldlvaalgaalsvalilglpilflgtge-----------------------------------------
00404191   1/1  qeellelldelaer.gv-----------------------------------------------------
00498811   1/1  ygaadividnd.lsleev----------------------------------------------------
00470731   1/1  eldppdreerleilkrllkklg.tvldvthddel.arla-------------------------------
00405881   1/1  lleelggtvvlvSahdgegldelldailel----------------------------------------
00477011   1/1  ----------------------------------------------------------------------
00508671   1/1  ----------------------------------------------------------------------
00451571   1/1  ----------------------------------------------------------------------
00532471   1/1  llvlplpdlviyldadpeell...eRllkRgrdpeeqe....----------------------------
00439861   1/1  vilvsqltelildalaggg---------------------------------------------------
00392701   1/1  rllsgvtviattnrpeeldp--------------------------------------------------
00513251   1/1  pevlierlldrvllldegslvdlgvledllaslepl----------------------------------
00406781   1/1  leelrllsgvtviattnd----------------------------------------------------
00432181   1/1  ----------------------------------------------------------------------
00499191   1/1  speelleRllk-----------------------------------------------------------
00469161   1/1  dteeviee--------------------------------------------------------------
00517691   1/1  degvslpqtrevlll-------------------------------------------------------
00444381   1/1  sggfkqrvgia..lladpgilflDEidkllddrg------------------------------------
00515351   1/1  ----------------------------------------------------------------------
00499331   1/1  yeeltrdlielyeeadrvividag.....lsieevvee...-----------------------------
00489631   1/1  eryradlvivtddlevv-----------------------------------------------------
00527261   1/1  vsskelleaLlr----------------------------------------------------------
00409841   1/1  lvvdadrglleqdlel------------------------------------------------------
00482551   1/1  lakelgvtviltsql-------------------------------------------------------
00437901   1/1  ilt-------------------------------------------------------------------
00386741   1/1  dglllpsgvlvi----------------------------------------------------------
00394721   1/1  lviattnrpellgrleldpallrrfdviel----------------------------------------
00509891   1/1  ldgivllvdaidrleaadl---------------------------------------------------
00476071   1/1  ----------------------------------------------------------------------
00437921   1/1  tnr-------------------------------------------------------------------
00519581   1/1  ifithde---------------------------------------------------------------
00410321   1/1  ----------------------------------------------------------------------
00420941   1/1  ldglqalsnvtviattnrpeeldpallrpgRfdl------------------------------------
00478081   1/1  dadpevlleRllkR............grrerkddseevlell----------------------------
00420081   1/1  ----------------------------------------------------------------------
00402371   1/1  aatnrpelvklgeldpallrRfdvielp------------------------------------------
00511381   1/1  lemdfagelfegsllL------------------------------------------------------
00495771   1/1  ----------------------------------------------------------------------
00401211   1/1  ----------------------------------------------------------------------
00533151   1/1  ----------------------------------------------------------------------
00461621   1/1  lpdlvifldasp----------------------------------------------------------
00472911   1/1  dadpevlleRl-----------------------------------------------------------
00482721   1/1  eeeiekrleryreiapl-----------------------------------------------------
00478391   1/1  pleelleRllkr.....grhpeseevleerleryepllep------------------------------
00471271   1/1  ----------------------------------------------------------------------
00489391   1/1  peelleRllkr-----------------------------------------------------------
00521551   1/1  ed--------------------------------------------------------------------
00487061   1/1  llggldleevkale--------------------------------------------------------
00493171   1/1  ----------------------------------------------------------------------
00410531   1/1  KlDlldalllrevsaelalelakelg--------------------------------------------
00367291   1/1  ldpevqna--------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00496061   1/1  ----------------------------------------------------------------------
00457851   1/1  ----------------------------------------------------------------------
00416171   1/1  ----------------------------------------------------------------------
00378621   1/1  ----------------------------------------------------------------------
00523461   1/1  ----------------------------------------------------------------------
00470231   1/1  ----------------------------------------------------------------------
00477561   1/1  grpdlvi---------------------------------------------------------------
00457881   1/1  ----------------------------------------------------------------------
00414001   1/1  ----------------------------------------------------------------------
00488191   1/1  ----------------------------------------------------------------------
00482661   1/1  .......................-----------------------------------------------
00477721   1/1  ----------------------------------------------------------------------