[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81487.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   1::208  1.3e-41 37.1% 0044796 00447961 1/1   ike                                     
   1::218  2.5e-37 37.4% 0050797 00507971 1/1   ike                                     
   1::218  2.9e-37 37.5% 0042929 00429291 1/1   ike                                     
   1::209    7e-37 35.1% 0052884 00528841 1/1   ike                                     
   3::211  2.6e-36 36.9% 0051870 00518701 1/1   ike                                     
   3::221  8.7e-36 32.9% 0046572 00465721 1/1   ike                                     
   1::218  1.3e-35 34.0% 0045131 00451311 1/1   ike                                     
   1::218    4e-34 34.8% 0053006 00530061 1/1   ike                                     
   1::219  5.7e-34 35.1% 0053041 00530411 1/1   ike                                     
   1::209  1.5e-33 34.9% 0051632 00516321 1/1   ike                                     
   1::221  3.6e-33 34.0% 0040685 00406851 1/1   ike                                     
   1::200  4.6e-32 37.2% 0043957 00439571 1/1   ike                                     
   2::200  5.9e-31 35.0% 0052933 00529331 1/1   ike                                     
   1::212  2.6e-30 39.4% 0052740 00527401 1/1   ike                                     
   1::201  7.2e-30 34.2% 0037518 00375181 1/1   ike                                     
   1::219  1.6e-29 37.4% 0051764 00517641 1/1   ike                                     
   1::210  3.5e-29 35.3% 0052698 00526981 1/1   ike                                     
   1::212  3.6e-29 33.9% 0052660 00526601 1/1   ike                                     
   1::211  4.9e-28 33.3% 0052115 00521151 1/1   ike                                     
   1::218  5.9e-28 33.0% 0049067 00490671 1/1   ike                                     
   1::218  8.4e-27 33.2% 0053003 00530031 1/1   ike                                     
   1::217  9.8e-27 30.7% 0051387 00513871 1/1   ike                                     
   1::220  2.3e-26 33.3% 0049814 00498141 1/1   ike                                     
   1::212  4.7e-26 35.5% 0051324 00513241 1/1   ike                                     
   1::198  1.8e-24 35.2% 0052850 00528501 1/1   ike                                     
   1::218    4e-24 32.7% 0050723 00507231 1/1   ike                                     
   1::212  4.7e-24 32.0% 0051416 00514161 1/1   ike                                     
   2::212  2.3e-23 29.3% 0051280 00512801 1/1   ike                                     
   1::202  2.6e-23 32.6% 0052186 00521861 1/1   ike                                     
   1::211  4.1e-22 32.2% 0050211 00502111 1/1   ike                                     
   1::198  1.4e-20 27.9% 0043284 00432841 1/1   ike                                     
   1::215  1.6e-19 29.9% 0047938 00479381 1/1   ike                                     
   1::218  5.7e-19 31.5% 0050690 00506901 1/1   ike                                     
   1::214  1.8e-18 31.0% 0040925 00409251 1/1   ike                                     
   1::200  6.9e-18 34.4% 0040657 00406571 1/1   ike                                     
   1::198  8.2e-18 29.0% 0049302 00493021 1/1   ike                                     
   1::193  1.3e-17 30.1% 0047540 00475401 1/1   ike                                     
   1::197  9.3e-17 35.9% 0047721 00477211 1/1   ike                                     
   1::193  4.6e-16 30.6% 0041356 00413561 1/1   ike                                     
   1::198  2.2e-15 31.8% 0052665 00526651 1/1   ike                                     
   1::193  2.2e-13 31.5% 0048396 00483961 1/1   ike                                     
   1::193  3.9e-12 31.7% 0049197 00491971 1/1   ike                                     
   2::193    1e-10 27.8% 0048428 00484281 1/1   ike                                     
   3::193  1.4e-10 29.3% 0051495 00514951 1/1   ike                                     
   2::205    1e-08 21.0% 0051058 00510581 1/1   ike                                     
   1::197  4.5e-08 24.4% 0049203 00492031 1/1   ike                                     
   3::200  6.4e-08 29.1% 0048300 00483001 1/1   ike                                     
   1::193  1.7e-07 25.4% 0051800 00518001 1/1   ike                                     
   1::197  0.00053 28.0% 0051937 00519371 1/1   ike                                     
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLETALGLWREFHR
00447961   1/1  MikavlFDldgTLvdtepvlalnrlleelglpl.eellrlllglgleelllrllageisleeflallgea
00507971   1/1  mikaviFDldGTLvdsepliaaalnelleelglplldleelreliglslrellrrllegggidleellee
00429291   1/1  mikavlFDldGTLvdseplaaalnellaelglplse....eellralvglgllaleggyidfeellrell
00528841   1/1  MslskikavlFDlDGTLvdsepliaealnelleelglpldleellrallgklllellrrllgrggldlee
00518701   1/1  --kavlFDldgTLldtepllalrellaelglpldeellralllelwar.........yergglsleellr
00465721   1/1  --kavlFDlDGTLvepdiaaalnellaelglelllllleelrallgelllallrglldfeellelllell
00451311   1/1  MikavlfDldGTLv.................dsepvlaaalnealeelglp.ldleelralvglglrell
00530061   1/1  MkikaviFDlDGTLv.................dsepliaaalnealeelglp.lslellrrllglglrel
00530411   1/1  lmmikaviFDlDGTLv.................dsepliaaalnealaelglpllteellrallglslre
00516321   1/1  llmlmmikavlFDldGTLldssfvvdvlf..............pyalealglflrehgleeevarllgla
00406851   1/1  mikavlFDlDGTLvdsepllaealnelleelglplsllellrrligls..............lrealrll
00439571   1/1  MkikaviFDlDGTLvd.................sepliaealnealaelglpltlaellrrliglglrel
00529331   1/1  -ikaviFDlDGTLl.................dsepliaealnealaelglplldaeelraliglglrell
00527401   1/1  mikavlfDlDgTLidsep....................................................
00375181   1/1  mikaviFDlDGTLvdseplv................iaealnealeelglp.lsleeirsliglglrell
00517641   1/1  lmmikaviFDlDGTLvdsepliaaalnealeelglpllteellrrll...................glsl
00526981   1/1  MkikaviFDlDGTLvdseplilaalnealaelglpldleelrall...................glslre
00526601   1/1  kikavlFDlDGTLvdsepliaralnealaelglpltlaellrrligls..............lrellrll
00521151   1/1  MkikavlfDlDGtLldgdp...lipgalealkllreagipvvlvTNnsgrsrellaellaelglpvdeee
00490671   1/1  iklvlfDlDGtLlnddklipgakealkelkkgikvviaTgrsylsvlelleelgllgivvtnngilvldl
00530031   1/1  mikaviFDlDGTLvdseplilealnealael....glp.ldleelrrliglglr....ellelllerlgl
00513871   1/1  kikavlfDlDGTLldgdeaipgavealkrlreagipvvlvTNnstrsraalaekleelglldvsedeilt
00498141   1/1  MlkkikavifDlDgTLvdseplllealdelleelglellll.............................
00513241   1/1  llllvldlllilllllvlmkikaviFDlDGTLidtesglvfalna.........................
00528501   1/1  DkikavlfDldGTlldsefvsevlfelllealakllaeslatglpleelrklagelrl............
00507231   1/1  kikavlfDlDGTLldgdeaipgaveallrlrelgkpvvlvTNnstrsraelaeklseklglpvsedeilt
00514161   1/1  kykavlfDlDGTLl..............dgdeaipgalealkllreagkpvvfvTNnstrsreelaekle
00512801   1/1  -ykavlfDlDGTLldgdeaipgalealaalrelglpvvfvTNnstrsreelaeklrglglidvlldeilt
00521861   1/1  dparlldlllklvmkgmkiklviFDlDGTLl.................dfdseplllaalnealkelgll
00502111   1/1  lellmkikavlfDlDGTLldsdelipgalealaalrelglpvvlvTNnsgrsreelaekliglgldvlld
00432841   1/1  MkkiklilfDlDGTLldsddkispeviealaalreagikvviaTGrpletaleiakelgldlpldyvite
00479381   1/1  HkiklilfDlDGTLtdsdpti.................spaaiaalaalaekgipvviatgrsleevlel
00506901   1/1  miklilfDlDGTLt.................dsehliaealiealaelaekgipvvivtgrpleellell
00409251   1/1  mikavlfDmDGvLaDtegailealnelfaelglplledlvgillreiygllrpelgslarlilelrgffr
00406571   1/1  nlllkkikavifDlDGTLldsepll.............................................
00493021   1/1  MkiklilfDlDGTLldgdplipaliealaalekgipvvlvTgrplaeieellkelglglpd.eliaenga
00475401   1/1  lgkiklivfDlDGTLtdsetiealke.lagkgirvllatgrallglldlleelgldlallaengaevlgl
00477211   1/1  rlakiklvvfDlDGTLtdgepll...............................................
00413561   1/1  MikliafDlDGTLldsdktiseetiealkklkegikvviaTgrplasvlellkelgldgdpliasnGalv
00526651   1/1  lkkkklvifDfDGTltdsdsidelaellg..........gpevaaltelamggg...lsfeealrrrlel
00483961   1/1  lnaletlgsiklvvfDkDGTLtdgep...idelakalgle.............eeveeltglglegeldf
00491971   1/1  kiklvvfDlDGTLtdedi....lelaaeagir....vtlatgrglldfaellrervallaengalledlg
00484281   1/1  -iklivfDlDGTLtdgdptisdatlealkelrelgiavvlatgrplaailellkelgl...dlpliaenG
00514951   1/1  --lllqgynvaklaldaavklvsveeiekslkgkkplavvfDlDgTlldsspylaaalne..........
00510581   1/1  -ikllvlDlDGTLldsd.....................................................
00492031   1/1  mikliafDlDGTLldndmtvs................lpetiealkklkekgikvviaTgrplasvlkll
00483001   1/1  --alllqgynvaklaldeaiklvsveqiekslkgkkplavgfDlDdTlldsspyf...............
00518001   1/1  MkikliafDlDGTLl.................dsdktispeaiealkrlaek.ipvvivTgrplagllel
00519371   1/1  kiklvvfDkdGTLtdg......................................................


                         -         -         *         -         -         -         -:140
query           RLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLAVVSNWDATLPEILEVVGLGR
00447961   1/1  llglleelgldllleellelylellle..llklypgvvelLealkarglklavltngllllsrellelll
00507971   1/1  alrllleelglelleelleaylell...leelelypgvlelLeaLka.giklailTngsrellerlleal
00429291   1/1  rllleelgld.laeelleayleay...aelplypgvvelLeaLk..glrlailtngsrellelllerlgl
00528841   1/1  llrellallleelglgldleellallldlygtllaeelelfpgalelLeaLk.agiklaivTngsrelae
00518701   1/1  llleelgldldleellalylell.....lplypgvlelLealkeagyklailtngsrellelllealpgl
00465721   1/1  glllkelgldelieeflelylellaeg..lelypgalelleaLkaaGiklaivTngsgisrelaealler
00451311   1/1  gglldfgelleealallleelgldlleellelyralllelplfpgvvelLealkaaGiklailTngsrel
00530061   1/1  lrrll.lleelleelleeflelylelleelelfpgvlelLealka.giklavvTngsrelaeallealgl
00530411   1/1  llrrllellglllglgldeeeleelleaylelylellleelrlypgvlelLealkargiklavvTngpre
00516321   1/1  lalaeldllkllaylllrllvgayedgelsleealrlvlellgldlkdealkelqgliweegyasgelkl
00406851   1/1  leelgldlseeeleellerylelylelllsleelklfpgvlelLeaLkargiklavvTnssr.aelllea
00439571   1/1  lrlllellgldlaeleelleeflelylellleelplfpgvrelLaalkaagiklavvTngprelaealle
00529331   1/1  erlleelgld..eelleellelylellleelklypgvlellealkeagiklavvTngsrlaeallealgl
00527401   1/1  ..................llyllalleelklfpgvlellealkaagiklaivTngsrlargllslellld
00375181   1/1  ralleelgvlllllellgrllleediealleellelylellaellppfpgvkelleaLkerGiklavvTn
00517641   1/1  rellrrlleelgldelleeflelylellae..elklfpgvlelLealka.giklavvTngsrelaellle
00526981   1/1  llerllld...eeeleellelylelyle..llvlfpgvlellealkaagiklavvTnksreaelllealg
00526601   1/1  leelgldldaellaallelylelllde...lplfpgvlelLeal...giplavvTnssralaelllealg
00521151   1/1  iltsagaaarlllellgkkvlvlgeeglleellelglelldldpdavlvgldlelypgvlellellkarg
00490671   1/1  slgllneldlllllsllvlaeylkelllgnlvyvlgedgliylklllilllllnlmmmikaviFDlDGTL
00530031   1/1  dldlseelleellalyrelylelllaeelrllpgvrellealkarsgiklavaTnkprelaerllealgl
00513871   1/1  sggaaarlllerll.gkkvlvlgeeglleeleelgielvdedvdavlvgldtelypgvlelllllkargl
00498141   1/1  ..............................leelklfpgvlellkalkergiklaivTngsrlelaeall
00513241   1/1  ............................................ldelelypgvieaLkaLkaaGyklvi
00528501   1/1  ...................elleallgllgldlsaeeldellgefleelykelleklklipgvlellkkl
00507231   1/1  sagaaadllkerll....gkkvlvlgeegllelleelgielvdldvdavvvgl....delllypglaeal
00514161   1/1  elglpdvseeeiltsagaaarlllerllgkkvlvlglerllellrelglelldedvdavvvgldlelypg
00512801   1/1  sglataalllellpglkvlvlgeeglleellelglelvdedpdavvvgldlrl..ypgvlellaalkarg
00521861   1/1  ppedldelrkllglglrellaglltelalrgefeellrerlallaelglfleeyeellaeiedplrpgak
00502111   1/1  eiltsalalaallkeilp...glkvlvlgeerllelleelglelvdldadavvvgl....delllypgll
00432841   1/1  ngaliydlkdgevlllkgldeelleellelllelgldlllesldgayieeknealaylaelllllplypg
00479381   1/1  lgelglrgllialngalvlllge.......laledplrpgvkelleelkeagikvaivtgdnelllllld
00506901   1/1  gelglrlyliaengalildpdgellalaldlyllgllalld.lrpgarellaelkeagikvaivtgdnre
00409251   1/1  ...........................elepipgavealkeLkalkgykvaivTnspralaeavleklag
00406571   1/1  ........................hyaleeagedklypgvvellkalkarGyklaivTgrpgelaealle
00493021   1/1  liyvlggevl.gllellleeylelleelllllll.....................plrpgakel.....e
00475401   1/1  lale..........................dplrpgakellealkeagikvaivtgdnretaeaileelg
00477211   1/1  ........................lallalldrlrpgalealkalkeagikvaivTgrssataralleel
00413561   1/1  ydldg..........evlllkgldeelllellellaelglrvlllal..dgvyileedlellgllalldp
00526651   1/1  lk....glpeeellellae..........dlplrpgakellkklkergiplaivSggfgefiealleklg
00483961   1/1  revllgrlallaglseeellgllal..........edplrpgakellaalkeagikvaivsgdnretaea
00491971   1/1  elaled.......................plrpgalelldalk.agikvvivsgdftetaepiakelgld
00484281   1/1  alifdldgtlilaevldeelllgllellaelglrvlalaedalygeldfeelllealdllaglvdgvltd
00514951   1/1  .......................................flpesgsylklplfwekyekgadefslpypg
00510581   1/1  ......................gllleelklrpgviealkklkeaGikiviaTgrslrt.....aealle
00492031   1/1  eelglddpliaenGaliyddgevllltgldrellleilellaelglrvlaladkdgvylekdltllglla
00483001   1/1  ..................................ayglklgspnsldyllnpefwekyvqsldelsipvp
00518001   1/1  lgegllglpdyliaenGaliyddgellylagldaelleelldlleelllelldelylertpglvieakel
00519371   1/1  ........................laledplrpgakealkalkeagikvvilTgdnlltaeaiakelgld


                         +         -         -         -         -         *         -:210
query           YFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGDAEADLLGAEAVGMRALLFDPLGENPKALPR
00447961   1/1  ealglldyfdaivssddvgvgKPdpeiyllalerlgvdpeeclfvgDsladilaAraaGmrtvlvnrg--
00507971   1/1  glldyfdaivtsddvgvgKPdpeifllalerlgvdpeealmvgDsletdilaAkaaGmrtvlvnrggtpl
00429291   1/1  ldyfdavvssddvgagKPdpeiyllalerlgvdpeeclfvgDsladlaaAraaGmrtvlvnrggealeel
00528841   1/1  allerlglddyfdgvvtsddvgvgKPdpeiyllalerlgvdpeevlmvGDslenDieaakaaGlrltvl-
00518701   1/1  ldlfdaivssedvgvrKPdpeiyllalerlgvdpeealfvgDsladieaAkaaGmrtvlvnrggtlleel
00465721   1/1  llglddyfdgivtsddvgagKPdpeifllalerlgvdpeevlfvGDslnDieaakaaGlrtvlvlrggna
00451311   1/1  aeallerlglddyfdavlssddvgvaKPdpeiyllalerlgvdpeevlfvgDslndilaakaaGmrtvgv
00530061   1/1  ldyfdaivtsddvgrgKPdpdifllalerlgvdpeeclmvGDslndieaakaaGmrtvgvatgyapeeel
00530411   1/1  laeallealglddyfdaivssddvgvgKPdpeifllalerlgvdpeevlmvGDslnDilaAkaaGmrtvg
00516321   1/1  plfpdvleaLealkeaGlklailSngsveaaklllehlglgdlfdlvlgsfdevggaKPdpeiylkale-
00406851   1/1  lglldyfdaivssddvgrgKPdpdifllalerlgvdpeeclvvgDsladieaAraaGmrtilvtrgylpa
00439571   1/1  rlglldyfdavvtsddvgrgKPdpeiyllalerlgvdpeeclvvgDslndleaakaaGmr----------
00529331   1/1  ldyfdaivtsddvgvrKPdpeifllalerlgvdpeeclmvGDslndieaAkaaGiktilv----------
00527401   1/1  llelleallealglplddyfldaivtsddvgvrKPdpeifllalerlgvdpeevlmvGDsltDilaakaa
00375181   1/1  kprelaealleelgledyffdvivtaddvpagKPdPeillkaleelgvepleevlmvGDsl---------
00517641   1/1  alglldyfdaivtsddvg..KPdpeifllalerlgvdpeealmvGDslndilaAkaaGiktvlvltgygs
00526981   1/1  lldyfdaivtsddvgvgKPdpeifllalerlgvdp..clmvGDsltDieaAkaaGmdtilvltgyglree
00526601   1/1  lldyfdavvsadlsldvgrgKPdPdiyllalerlgvdpeeclvvgDsladieaAraaGmrtvgvtrgyll
00521151   1/1  lll.ivtnkdrvlprlllgaggladyfdavvgsdpvgvgKPdpaiflaalerlgvdpeevlmvGDslntD
00490671   1/1  vd.................seplileafneealeelglelldleelrrliglgleeileellg.lseeei
00530031   1/1  ddyfdaivggddvg.gKPdPdifaellllalerlgvdpeevlmvGDslnDieaaraaGmrtigvatgygs
00513871   1/1  ll.ivtnkdlvlprelllrlglgalfdaivtatgrepvgvgKPdpaifllalellgvdpeevlmvGDsln
00498141   1/1  eklglddyfdaivssdd.....pkpeiylkaleklgldpeevlfvgDslndieaakaaGlktvlvnrgyt
00513241   1/1  vTnqsgigrglfsledfralaealleklgl..yfdpvigsddvgcrKPkpgmllaalerlglgllidpee
00528501   1/1  k....klaivTngsrealellleklllheklanllggllglfdgivssddvg.rKPdp------------
00507231   1/1  dllk..ggalaivtnkdlvlprelllrlglgalfdaleaavgsepvgvgKPdpaifllalerlgvdpeev
00514161   1/1  vlellallkerglll.iatngdrrlprelllrlglgaffdaleaatgsepvgvgKPdpeifelalerlgv
00512801   1/1  lll.iatnkdrvlprelllrlglgalfdaivgatgrepvgvgKPdpaifelalerlgldpeevlmvGDsl
00521861   1/1  ellealkaaGiklaivTggprefaeaileklglddyfdvvvgsdlevdedgeltglvedvvf--------
00502111   1/1  ellealk..ggklaiatnkdrvlprelllalglgalfdaivtaddrkplvgvgKPdpaillaalerlgvd
00432841   1/1  vlellealkarglklaivtggdrllalllllllglddfldvvlsgdtvleikpkpvsK------------
00479381   1/1  ldletaeaiakelg..dlfdvvlsgdvvaevkpdgvdKpealeallerlgldpeevlmvGDgvnDlpalk
00506901   1/1  taeaiaeelgld..fdvvvsgvfaevlpekpdKpeallallerlgvdpeevlmvGDgvnDlpalkaagv.
00409251   1/1  leelfd..........gkpdpdiyltalkrl...peecllidDspedieaaraagmetilvtaghnrdla
00406571   1/1  llgllglfdgvvllngallllgdevilrkpdpeiklellkellgldpeevlavGDslnDi----------
00493021   1/1  agiklaihvtlgdneetaeaiakellsllpgldevfsgvvgaevlpegkpKpealeal------------
00475401   1/1  lddvfanvlegddgrstglvleivvkpkpKpeallalleklgidpeevlavGD-----------------
00477211   1/1  gldevfa.........ggkpkpkallalleelglspeevaavGDginDlpalaaagl-------------
00413561   1/1  lrpgvkelleelkkagikvaiitgdneelaellailkelgld.yfdvvlsgdv-----------------
00526651   1/1  lpdyifanellfddggltgvvlgadvfgrrkpkpelkleileelgldpeevimiGDgv------------
00483961   1/1  iaeklgideenvlanelefddggyftgivtvdarvlpkpKpeivkllleklg.-----------------
00491971   1/1  elfanvlevddsgltvleikpspeqKaealealgidgeeviavGDgaNDlpml-----------------
00484281   1/1  llidltllglialadplrpgakellaa..kagikvviltgdnlleetaeaiak-----------------
00514951   1/1  akelldalkkrGvkiaivTnrpeenaeltlkalgilglipv.........vkp-----------------
00510581   1/1  klglddyvivengalvhdkpydelllrlpidleevlaiGDslndiemlkaaglgvalvnagdelk-----
00492031   1/1  lldplrpgvvealeelkdagikvaiitgdneeldeaeailkelgi.dlvdvvlsggv-------------
00483001   1/1  gAkelldalrkrGdkvvvvTnrsesl........leptlklllkglgipvdkphpllftg----------
00518001   1/1  sltlhvrdalellkergiklliitndelleellallealglelgldvvlsgdi-----------------
00519371   1/1  l.....vfarvlpvdKaaavkllla.......geevaavGDglnDlpalkaagvgva-------------


                         -         -         -         +         -         -         -:280
query           LERVLDYLP-------------------------------------------------------------
00447961   1/1  ----------------------------------------------------------------------
00507971   1/1  eelagpdy--------------------------------------------------------------
00429291   1/1  eellllll--------------------------------------------------------------
00528841   1/1  ----------------------------------------------------------------------
00518701   1/1  e---------------------------------------------------------------------
00465721   1/1  aeelka.lvld-----------------------------------------------------------
00451311   1/1  arggngld--------------------------------------------------------------
00530061   1/1  agadlvid--------------------------------------------------------------
00530411   1/1  vargygple-------------------------------------------------------------
00516321   1/1  ----------------------------------------------------------------------
00406851   1/1  eadlvvdslae-----------------------------------------------------------
00439571   1/1  ----------------------------------------------------------------------
00529331   1/1  ----------------------------------------------------------------------
00527401   1/1  Gl--------------------------------------------------------------------
00375181   1/1  ----------------------------------------------------------------------
00517641   1/1  aeelaaaga-------------------------------------------------------------
00526981   1/1  ----------------------------------------------------------------------
00526601   1/1  lp--------------------------------------------------------------------
00521151   1/1  i---------------------------------------------------------------------
00490671   1/1  eellelyr--------------------------------------------------------------
00530031   1/1  aeelaaag--------------------------------------------------------------
00513871   1/1  tDilgan---------------------------------------------------------------
00498141   1/1  lkelldladd------------------------------------------------------------
00513241   1/1  sl--------------------------------------------------------------------
00528501   1/1  ----------------------------------------------------------------------
00507231   1/1  lmvGDsle--------------------------------------------------------------
00514161   1/1  dp--------------------------------------------------------------------
00512801   1/1  lt--------------------------------------------------------------------
00521861   1/1  ----------------------------------------------------------------------
00502111   1/1  p---------------------------------------------------------------------
00432841   1/1  ----------------------------------------------------------------------
00479381   1/1  a.gvl-----------------------------------------------------------------
00506901   1/1  gvavgngt--------------------------------------------------------------
00409251   1/1  laga------------------------------------------------------------------
00406571   1/1  ----------------------------------------------------------------------
00493021   1/1  ----------------------------------------------------------------------
00475401   1/1  ----------------------------------------------------------------------
00477211   1/1  ----------------------------------------------------------------------
00413561   1/1  ----------------------------------------------------------------------
00526651   1/1  ----------------------------------------------------------------------
00483961   1/1  ----------------------------------------------------------------------
00491971   1/1  ----------------------------------------------------------------------
00484281   1/1  ----------------------------------------------------------------------
00514951   1/1  ----------------------------------------------------------------------
00510581   1/1  ----------------------------------------------------------------------
00492031   1/1  ----------------------------------------------------------------------
00483001   1/1  ----------------------------------------------------------------------
00518001   1/1  ----------------------------------------------------------------------
00519371   1/1  ----------------------------------------------------------------------