[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81497.1


[Show Plain Result]

## Summary of Sequence Search
   1::725
 188::414  7.3e-53 38.1% 0043869 00438691 1/2   C-terminal domain-like                  
   3::190  5.8e-50 35.8% 0049528 00495281 1/2   N-terminal domain-like                  
  27::189  2.2e-48 39.8% 0050217 00502171 1/2   N-terminal domain-like                  
 191::371  2.4e-48 38.7% 0049529 00495291 1/2   C-terminal domain-like                  
  11::189  6.5e-46 37.0% 0050216 00502161 1/2   N-terminal domain-like                  
 387::552  2.8e-44 47.5% 0050217 00502172 2/2   N-terminal domain-like                  
 189::368  3.1e-44 39.1% 0044822 00448221 1/2   C-terminal domain-like                  
 375::555  4.7e-41 45.9% 0043867 00438672 2/2   N-terminal domain-like                  
 379::553    4e-40 39.1% 0049528 00495282 2/2   N-terminal domain-like                  
 555::723  5.8e-39 42.3% 0043869 00438692 2/2   C-terminal domain-like                  
 378::552  9.2e-36 40.1% 0050216 00502162 2/2   N-terminal domain-like                  
 558::722  2.1e-35 41.8% 0049529 00495292 2/2   C-terminal domain-like                  
 556::719  3.8e-33 40.9% 0044822 00448222 2/2   C-terminal domain-like                  
  30::186  8.5e-33 32.0% 0046171 00461711 1/2   N-terminal domain-like                  
  36::182  4.6e-27 30.8% 0050291 00502911 1/2   N-terminal domain-like                  
 403::548    7e-23 31.6% 0050291 00502912 2/2   N-terminal domain-like                  
 401::553  3.3e-22 32.0% 0046171 00461712 2/2   N-terminal domain-like                  
   7::45   3.2e-08 41.0% 0049526 00495261 1/1   synthase PurL, linker domain            
 184::352  2.3e-07 27.3% 0050292 00502921 1/2   C-terminal domain-like                  
  56::160    0.011 35.2% 0043867 00438671 1/2   N-terminal domain-like                  
 551::705      3.7 24.6% 0050292 00502922 2/2   C-terminal domain-like                  
   1::725


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  --ifnadlvidgedleeallkllrlpnvaskeflitqyddhvggltvlkplvglp.........pgadaa
00502171   1/2  --------------------------tdtelevllltllehcniaskelileqydhtvggntvlgpgddA
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  ----------eldylllllegldlkpalvellalpnvaskhclikifdrtvgg......gvllgpgddaa
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  -----------------------------elllykvagvdisaglasvelikrlvlstvrpnvlvglgdd
00502911   1/2  -----------------------------------lllsellefelidrll......rllvllgigddaa
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ------glaLsldelellvelfkelgrnPtdvEllvlaqawSeHC-------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  -------------------------------------------------------kpgvGplqlpvaDaa
00502922   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  vvrlgedtglamkvethnhpsaidPyaGAatavgeairdivavGrGakpiAgldglnfgnleipglsapw
00502171   1/2  avirigdglalalktdthnrpsaidpyggaatavaeavrdilamGArplalldvlnfgdpd..lpekllq
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  vvrlgddtglvmstdghntpllidpyagaatavaeavrDiaamGArplalldslafgnl........lae
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  AavldldlgldglalvlttDgvvtkllfapllgapdtiGilavavnvnDlaamGAePlalldylalgeld
00502911   1/2  vldlgdgl.lvvttDglveglhfllvldpydiGilavavnlsDiaamGArPlalllslalpegldve...
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  vvrlslgtlkglamsiGenpryalldpyagaalAvaEalrnlvaagagpladvtlslnfgwpegnpeela
00502922   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
00438691   1/2  -----------------------------------------------pdfkkpGdvllllglstgrdglg
00495281   1/2  eaaagkpgeiaspldilveavlGiadygnalgiPvigGkdslsnetvgkd--------------------
00502171   1/2  lvveGiadacnalgvpvvgGnvslyneyvgkpilptlvigavgkldvvr---------------------
00495291   1/2  --------------------------------------------------lkpGdlllllglttgriglg
00502161   1/2  avkGiadacnalgvplvgGktslspetvipptlvvgavGvveddrvirg---------------------
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  ------------------------------------------------dfakpGdvlillglltgrdglg
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  ....velleeiveGiaeacreagvplvGGdtavvpglyldgeltla------------------------
00502911   1/2  vleeivegiaeaaeeagvplvGGdtalgpe....ltlsvtav----------------------------
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  -------------------------------------------kllrrsgakpGdlllv....tgplGdg
00438671   1/2  qlyeavlalgkdacralgvp--------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GAAFASRELKEEKAEDRPAVQVGDPFLGKLLMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGV
00438691   1/2  gsalasvllg....lgfgavqvgdpelekklfeavlelieeglilaahDvsdGGLavalaEmafagglGa
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  gsalasvllglgsgeldlpdvqvgdpellkklqelieallelieeglilaahDvsdGGlavalaEmafag
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  Gsallsvllglg.dldfgavpvgdlellkrlveallelieeglvlaahDvsdGGlavalaemafasglGa
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  alglallrggleldeellslllellllpnprlaallallg..lvhamtDvt.GGLlgdllelaeasgvga
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           ELHLDLVPTREEGMTPEELLLSESQERMVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGE
00438691   1/2  eidldavp.....lsplellfse.qermvlaVkpedaeavlaileraglpelaaviGevtedgrlvitvg
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  glGaeidldavplreegldpleilfsEsqgrlvlavkpedleavlailekeglpaaviGevtedgrlvlk
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  eidldkvplrpegldllellfsesqgrlvlavppedaeavleilekaglpaaviGevtedgrlvvvlgge
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  vldldklpllpevlelaellgldpldlalsgGedyellftvppeladal........vdaaviGevtege
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           VVAEVPTEALAEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT
00438691   1/2  gevvvdlpldeLleawpetlrell..rlrdnpalaleeyelllgealprllalptvaskeflia------
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  talggervvdlpleellgawp-------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ------------------------------------tdtelevllltllehcniaskelileqydhtvgg
00448221   1/2  vvvdlpldellgawpetl----------------------------------------------------
00438672   2/2  ------------------------etlkaalealdlslldlneallrvLshpnvaskeflvrqyDrsvgg
00495282   2/2  ----------------------------ifnadlvidgedleeallkllrlpnvaskeflitqyddhvgg
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  ---------------------------eldylllllegldlkpalvellalpnvaskhclikifdrtvgg
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  ----------------------------------------------------lllsellefelidrllrl
00461712   2/2  --------------------------------------------------elllykvagvdisaglasve
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  gv--------------------------------------------------------------------
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKPLAYTDGLNLG
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ntvlgpg.ddAaviri.gdglalalktdthnrpsaidpyggaatavaeavrdilamGArplalldvlnfg
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  ltvlkpgvGplqlpvaDaavvrlslgtlkglamsiGenpryalldpyagaalAvaEalrnlvaagagpla
00495282   2/2  ltvlkplvglppgadaavvrl.gedtglamkvethnhpsaidPyaGAatavgeairdivavGrGakpiAg
00438692   2/2  ----------------------------------------------------------------------
00502162   2/2  gvllgpg.ddaavvrl.gddtglvmstdghntpllidpyagaatavaeavrDiaamGArplalldslafg
00495292   2/2  ----------------------------------------------------------------------
00448222   2/2  ----------------------------------------------------------------------
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  lvllgig.ddaavldlgdgl..lvvttDglveglhfllvldpydiGilavavnlsDiaamGArPlallls
00461712   2/2  likrlvlstvrpnvlvglg.ddAavldldlgldglalvlttDgvvtkllfapllgapdtiGilavavnvn
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           SPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAMVGVVGVLEVDKRAEMGFRRP
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  dpdlpekllqlv..veGiadacnalgvpvvgGnvslyneyvgkpilptlvigavgkldvvrg--------
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  dvtlslnfgwpegnpeelaqlyeavlalgkdacralgvpvvsGkvSlynetklkdggegkevaip-----
00495282   2/2  ldglnfgnleipglsapweaaagkpgeiaspldilveavlGiadygnalgiPvigGkdslsne-------
00438692   2/2  ----------------------------------------------------------------pdfkkp
00502162   2/2  nl........laeavkGiadacnalgvplvgGktslspetv...ipptlvvgavGvveddrv--------
00495292   2/2  -------------------------------------------------------------------lkp
00448222   2/2  -----------------------------------------------------------------dfakp
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  lalpegldve...vleeivegiaeaaeeagvplvGGdtalgpe.......ltlsvtav------------
00461712   2/2  DlaamGAePlalldylalgeld....velleeiveGiaeacreagvplvGGdtavvpgly.ld-------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  ------------------------------------------------------------kllrrsgakp


                         -         -         -         *         -         -         -:630
query           GEVLLLIGEERGELGASEVLYLLTGKEFGHPPRLDLGREKAVQEAIRDLIQRGLTRTAHDVAEGGLLLAL
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  GdvllllglstgrdglggsalasvllglgfgavqvgdpelekklfeavlelieeglilaahDvsdGGLav
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  GdlllllglttgriglggsalasvllglgsgeldlpdvqvgdpellkklqelieallelieeglilaahD
00448222   2/2  GdvlillglltgrdglgGsallsvllglgdldfgavpvgdlellkrlveallelieeglvlaahDvsdGG
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  Gdlllv....tgplGdgalglallrggleldeellslllellllpnprlaallallglvhamtDvt.GGL


                         -         +         -         -         -         -         *:700
query           AEMTFPYGVGATVEVREEGLEALFGEAPSRVLFTVEKTRLQEATLLLEERGLPYRVLGETGGKSLTVLTP
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  alaEmafagglGaeidldavplsplellfse.qermvlaVkpedaeavlaileraglpelaaviGevted
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  vsdGGlavalaEmafagglGaeidldavplreegldpleilfsEsqgrlvlavkpedleavlailekegl
00448222   2/2  lavalaemafasglGaeidldkvplrpegldllellfsesqgrlvlavppedaeavleilekaglpaavi
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  lgdllelaeasgvgavldldklpllpevlelaellgldpldlalsgGedyellftvppeladal......


                         -         -         -         -         +         -         -:770
query           GGVLEWSLEELLSAWKAPLREVLDG---------------------------------------------
00438691   1/2  ----------------------------------------------------------------------
00495281   1/2  ----------------------------------------------------------------------
00502171   1/2  ----------------------------------------------------------------------
00495291   1/2  ----------------------------------------------------------------------
00502161   1/2  ----------------------------------------------------------------------
00502172   2/2  ----------------------------------------------------------------------
00448221   1/2  ----------------------------------------------------------------------
00438672   2/2  ----------------------------------------------------------------------
00495282   2/2  ----------------------------------------------------------------------
00438692   2/2  grlvitvggevvvdlpldeLlea-----------------------------------------------
00502162   2/2  ----------------------------------------------------------------------
00495292   2/2  paaviGevtedgrlvlktalgg------------------------------------------------
00448222   2/2  Gevtedgrlvvvlggevvv---------------------------------------------------
00461711   1/2  ----------------------------------------------------------------------
00502911   1/2  ----------------------------------------------------------------------
00502912   2/2  ----------------------------------------------------------------------
00461712   2/2  ----------------------------------------------------------------------
00495261   1/1  ----------------------------------------------------------------------
00502921   1/2  ----------------------------------------------------------------------
00438671   1/2  ----------------------------------------------------------------------
00502922   2/2  ..vda-----------------------------------------------------------------