[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81529.1


[Show Plain Result]

## Summary of Sequence Search
   1::503
   1::219    1e-60 43.1% 0047949 00479491 1/1    I glutamine amidotransferase-like      
   1::184  1.9e-57 40.9% 0042722 00427221 1/1    I glutamine amidotransferase-like      
   1::186  5.2e-56 45.4% 0050645 00506451 1/1    I glutamine amidotransferase-like      
   1::190  8.6e-56 40.5% 0038211 00382111 1/1    I glutamine amidotransferase-like      
   2::227  2.3e-53 46.3% 0048482 00484821 1/1    I glutamine amidotransferase-like      
   2::187  3.4e-53 43.2% 0047286 00472861 1/1    I glutamine amidotransferase-like      
   1::184  8.8e-53 44.0% 0051730 00517301 1/1    I glutamine amidotransferase-like      
   2::187  2.2e-52 43.2% 0047324 00473241 1/1    I glutamine amidotransferase-like      
   1::191  3.4e-52 40.7% 0045752 00457521 1/1    I glutamine amidotransferase-like      
 175::425  1.7e-50 38.7% 0045391 00453911 1/1   ne nucleotide alpha hydrolases-like     
   1::188  4.2e-50 37.2% 0050138 00501381 1/1    I glutamine amidotransferase-like      
 190::382  3.7e-49 39.6% 0047035 00470351 1/1   ne nucleotide alpha hydrolases-like     
 383::503  1.8e-48 68.6% 0047036 00470361 1/1   ynthetase C-terminal dimerisation domai 
 208::426  2.2e-47 34.1% 0052117 00521171 1/1   ne nucleotide alpha hydrolases-like     
   1::200  2.8e-46 40.5% 0039782 00397821 1/1    I glutamine amidotransferase-like      
 179::396  7.4e-42 43.5% 0039538 00395381 1/1   ne nucleotide alpha hydrolases-like     
 190::432    8e-42 35.8% 0051038 00510381 1/1   ne nucleotide alpha hydrolases-like     
 188::405  3.5e-41 34.9% 0046213 00462131 1/1   ne nucleotide alpha hydrolases-like     
 175::432  1.2e-40 30.5% 0050739 00507391 1/1   ne nucleotide alpha hydrolases-like     
 186::406  9.7e-40 32.4% 0050746 00507461 1/1   ne nucleotide alpha hydrolases-like     
   1::184  3.8e-39 38.1% 0039988 00399881 1/1    I glutamine amidotransferase-like      
 193::389  8.4e-39 38.5% 0049476 00494761 1/1   ne nucleotide alpha hydrolases-like     
   1::184  9.6e-39 33.7% 0049298 00492981 1/1    I glutamine amidotransferase-like      
   1::193  1.4e-38 41.7% 0043181 00431811 1/1    I glutamine amidotransferase-like      
   1::180    1e-36 33.1% 0047771 00477711 1/1    I glutamine amidotransferase-like      
   2::190  4.2e-34 35.0% 0042648 00426481 1/1    I glutamine amidotransferase-like      
   1::189  2.5e-33 33.3% 0052900 00529001 1/1    I glutamine amidotransferase-like      
 197::405  2.3e-32 33.3% 0048369 00483691 1/1   ne nucleotide alpha hydrolases-like     
 178::426  4.4e-29 29.5% 0048858 00488581 1/1   ne nucleotide alpha hydrolases-like     
 210::372  8.7e-29 33.3% 0047848 00478481 1/1   ne nucleotide alpha hydrolases-like     
 209::372    9e-28 32.5% 0050233 00502331 1/1   ne nucleotide alpha hydrolases-like     
   1::185  5.6e-26 26.6% 0049527 00495271 1/1    I glutamine amidotransferase-like      
 200::379  8.3e-25 29.1% 0039977 00399771 1/1   ne nucleotide alpha hydrolases-like     
   1::136  2.1e-18 34.4% 0037903 00379031 1/1    I glutamine amidotransferase-like      
   2::181    1e-16 24.0% 0051742 00517421 1/1    I glutamine amidotransferase-like      
 207::371  4.3e-12 29.5% 0050128 00501281 1/1   ne nucleotide alpha hydrolases-like     
 196::316  8.4e-10 31.9% 0051645 00516451 1/1   ne nucleotide alpha hydrolases-like     
   1::166  3.5e-08 29.8% 0046884 00468841 1/1    I glutamine amidotransferase-like      
  27::86   2.8e-05 31.7% 0041867 00418671 1/1    I glutamine amidotransferase-like      
 207::272  0.00026 22.7% 0052363 00523631 1/1   ne nucleotide alpha hydrolases-like     
 208::271  0.00072 29.7% 0043381 00433811 1/1   ne nucleotide alpha hydrolases-like     
   1::503


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVLVLDFGSQYTRLIARRLRELRAFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
00479491   1/1  agkpvigvlpglvprilvldygsgnlyrsiaralreaGaevvvvpvdltleeipellddadglilpGGps
00427221   1/1  mkkiliidfgdsflynlvralrelgvevvvvpvdaltleeilllnpdglilpGGpgspydardeglleli
00506451   1/1  mkilvldfggsnleslaralrelgaevevvpvdldleeillldadglilpGGp.svgdaglleaireale
00382111   1/1  ialvgkkilildfggsftenlvralrelgvevevvpvdadlleillldpdglilpGGpgsprdeglieli
00484821   1/1  -mmkmkilvldlpgsgnlqsiaralreagvevvvvpaddltldeilledadglilpGGpgdpldlgalpr
00472861   1/1  -mkvllldygdsfteslaralrelgaevevvpvdlelletldeidlldpdglilpGGpgsvgdeglieai
00517301   1/1  mlkiliidfgdsftgsivralrelgvevevvpndadleelle..pdgiilsGGpgspadeglllialikl
00473241   1/1  -mkilvldfygsnteslvralrelgaevevvpvdleletlpeelllldpdglilpGGpgspdllglleai
00457521   1/1  leglgllelvlvlllldlleldlvawvsllelllnpggevriavidygsfyn..ilralrelgaevevvp
00453911   1/1  ----------------------------------------------------------------------
00501381   1/1  mgkpvigilgkyillldaydsvtaalylagrllgvgvevvvvgadvltleeipellddadglvlpGGpgs
00470351   1/1  ----------------------------------------------------------------------
00470361   1/1  ----------------------------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00397821   1/1  gallkvivivdygsgnlrdlaralrelgvevevvpid...edillldadglilPGggstvddlrllrleg
00395381   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00399881   1/1  mkilvidlggsnleslvdalrelgaevevvrvdvldeedle.dadalilPGggspadalrllrlegliea
00494761   1/1  ----------------------------------------------------------------------
00492981   1/1  kkevkiavvgdygsltgnllsilealehagaevvvkveilwvpsdlleeeilellkgadgillpGGpgdp
00431811   1/1  kmkiavldfggnytsll.ralreagaevvvvspdedle.....dadglilpGGpgtvyal.llrdeglle
00477711   1/1  kiivivdpgsgnlrdiaralrelgvevevvrdpedle.....dadgiilpGgfstrgdlrllrlsgliea
00426481   1/1  -lkaldgvkiavldfggnytsll.ralrelgaevvvvssled.....legadglilpGGfstvdllllrn
00529001   1/1  senifvmsedralrqdirplrIllLnlmpkkidtevqflrllgaqplqveltllridshlskntaalhlt
00483691   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  ilplakpkvavlvfpgsncdrdlaraferaGfeavlvhmsdllagrvllddfdglvlpGGfsygdvlggg
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  kkilvllfdgfellelasplralreagaevevvspdggpvtssnglalladltldevdledyDalilpGG
00517421   1/1  -aevligvlildggvgnhisvlaalerlgvevvvvrkpedlk.....didglilPGggsttiallallar
00501281   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  mkkllliggfrgdlslleplldllelltgdkpkigvipyagldldfegyyrsvldalerlGaevvvvsll
00418671   1/1  --------------------------alllskrlsllllllllkllaskkilvllfdgfedlelvgplda
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
00479491   1/1  dvddlgalrrdegllelirealergdlkPvlGIClGmQlLaealggkvikgpggeegvvvpvellglllv
00427221   1/1  realeagkPilGIClGhQllalalggkvlklkvgelgwnsvvltlvtdgsllfkglgdelivyfyHsyav
00506451   1/1  algkpvlGiClGmqllaealggkvvrlkvpehgwvsviltdgsplfkglgdeltvyfsHsyavdelpegl
00382111   1/1  realeagkPvlGiClGmQllalalggkvlklkvpelglnsvvlvldgglfeglpgtlrlyfyhslivrhs
00484821   1/1  ieglielirealeagkpvlGIClGhQlLaealggkverlpegpelgllpvevtegsplfrglgdelrvye
00472861   1/1  realeagvpvLGiClGhQllaealggkvlrlktgrlgwnsvvltegsplfkglgdvlivyfsHsyavtel
00517301   1/1  alelgiPiLGiClGhQllalalggkvvklkvgelgwnsvvltlgsplfkglgevlivyfyHsyavdelpe
00473241   1/1  realeagvpvLGiClGhQllaealggkvlrlktgelgwnsvvltegsplfkglgdvlivyfsHgyavdel
00457521   1/1  vdidaeelealdpdglilpGGpgdprrleglieairealeagkPvlGIClGhQllaealggkvvrlkvgh
00453911   1/1  ----------------------------------------------------------------------
00501381   1/1  pddlglleairealergkpvlGIClGmQllaealggkveklpgaelglldpevtrnvvglleesfvlvel
00470351   1/1  ----------------------------------------------------------------------
00470361   1/1  ----------------------------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00397821   1/1  lieairealeagkPvLGIClGmQlLaealggpgsvpglgllpgkvvrnkegrlvvphlgwnvvvl.dspl
00395381   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00399881   1/1  ireaaesgkpvlGIClGmqlLaealggkvgvpglglldgktvrlykgrlphvgvngplfkglpdpltvye
00494761   1/1  ----------------------------------------------------------------------
00492981   1/1  gveglieairealengiPvLGIClGmQllavalggnvlglkdahsgefseetnhpvlgllpglvlrnall
00431811   1/1  aireaaeagkpvlGiClGmqlLaealggkvvkglgllpgkvvteyrgltlpvvgadalfvglevvvhgye
00477711   1/1  irealergiPvLGIClGmQlLaealggpvgleglgllgggvlllgtlrlphmgwnllelplllgigegvy
00426481   1/1  sglleaireaaeagkPvlGiClGlqlLaealggpgvpglgllpgkverlalgrtvlslvgdlllpglgwn
00529001   1/1  rfyetfdlidlekfDgliitGgpvsvldfedvpwleelkellkwalenkkptLGiClGaqllayalggkv
00483691   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  aiaaasllmndklelallkffarrgkpvLGiCnGfQlLv.elgllpggdlldpaltrnasgrfesrwvtl
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  pgtvdllrdpgllelireaaeagkpvlgiClGaqlLaeagllggkvatthwleeee...lpeagan----
00517421   1/1  iglllalikfviakgkpvlGiClGmQlLaeasgepgvleglgeigglgllditvvrnafgrqphsgwndl
00501281   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  edpleaLp.daDglilpGG.ntfalldllretglleaireavengkpvlGiCaGmqllgesildpggleg
00418671   1/1  lrragaevvvvspdgg------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTPEHVLEELLREVRERAGKD
00479491   1/1  stlflglpspllkgsllapiaygvhsyevneihgdaveelpeglvvlatspdgsveaiegidhkdgnvlG
00427221   1/1  delpeglevlatslddglveaiehkdlpvfgvQfHPEsslgplg--------------------------
00506451   1/1  evlatsedgsieaielkdgpvlgvqfHPEftsgplglrllrnflea------------------------
00382111   1/1  hgdavnelpeglvvlatsddglveaiehkdlpvfgvQfHPEstsgplglr--------------------
00484821   1/1  iHsd.vtelpeglevlatsedgsieairhkd..vlgvqfHPE.fdsddglrllenflellg....llpln
00472861   1/1  peglevlats.dgtieaielkdgpvlgvqfHPElsltplglrlfrnf-----------------------
00517301   1/1  glevlatsddgpveairhkdlpifgvQfHPEvtstplglrllkn--------------------------
00473241   1/1  peglevlats.dgtieaielkdgpvfgvqfHPElsltplglrlfrnf-----------------------
00457521   1/1  sge......nsplfkglggdviivyhsHgyavnleslpeglevlatslndg-------------------
00453911   1/1  ----------------------------------vlknpildillvkldfdleeiiealveflrdyllks
00501381   1/1  lgvphlgwnpvalaegsllfkglgeeliverhrhryevhsdavdrllp----------------------
00470351   1/1  -------------------------------------------------eellerlveairdylllvgdk
00470361   1/1  ----------------------------------------------------------------------
00521171   1/1  -------------------------------------------------------------------lgg
00397821   1/1  fkglgeelrvyeiHsyavevndetlellpegllvlattedggviagaavekgnvlgvqfH----------
00395381   1/1  --------------------------------------fvldiaglsedeavealrelledavrrrlrgd
00510381   1/1  -------------------------------------------------idleelieelvellrdyvlkr
00462131   1/1  -----------------------------------------------rrywdlpfvpdleellealvell
00507391   1/1  ----------------------------------llenfivpilgvkldidleeiiealvlflkdylrkl
00507461   1/1  ---------------------------------------------ekllkkllkkvekaikdykllvggd
00399881   1/1  iHslrvevlpdgllvlars.dgliegiehkdgnvlGvqfHPefs--------------------------
00494761   1/1  ----------------------------------------------------skltldallllpalllal
00492981   1/1  elvdslsdlggtmrlGwhpvvlvegsllfkgygkgliivrhrHs--------------------------
00431811   1/1  vhsdaveelpeglevlatsddg.ieaie..hgnvlgvqfHpefts...glrll-----------------
00477711   1/1  gyevhsyrtlpnglavlaltedgviagaavrdgnvlGvqf------------------------------
00426481   1/1  lrgyeihadlveglpegaevlavhdg...agaavrkgnvlgvqfHpelsg--------------------
00529001   1/1  kkalpgkefGvfpvtltddgdpllrglpdeftvphsrytehhddvielp---------------------
00483691   1/1  --------------------------------------------------------eeaiklfrllkkgd
00488581   1/1  -------------------------------------rrYwdlpfldleeavealrellrdavrkrlvsd
00478481   1/1  ---------------------------------------------------------------------k
00502331   1/1  --------------------------------------------------------------------kk
00495271   1/1  rvenspsiflsglagsvlpvpvaHgegvfeladdlvlaaleedgq-------------------------
00399771   1/1  -----------------------------------------------------------iavlrrlmsgk
00379031   1/1  ----------------------------------------------------------------------
00517421   1/1  kikglsplfkgilnksifyfvhsyirapliedvgvtvavls-----------------------------
00501281   1/1  ------------------------------------------------------------------gtsg
00516451   1/1  -------------------------------------------------------aieilrealeefd..
00468841   1/1  aeggevpglgllpgvvvrhadgrqvd--------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00523631   1/1  ------------------------------------------------------------------lklm
00433811   1/1  -------------------------------------------------------------------lkk


                         -         -         -         +         -         -         -:280
query           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHGLLRLGEREEVEGALRALGVNLLVVDAKERFLKALKG
00479491   1/1  vQfHPEfts-------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00484821   1/1  ylelllellre....dl-----------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00453911   1/1  gakkvvlglSGGvDStvaaalakkalgrlplellgdellavtvdhglss..deedalelakklgidhelv
00501381   1/1  ----------------------------------------------------------------------
00470351   1/1  kvvvglSGGvDSsvlaallkkalgyevlavtvdtgllrseeeledaeklaeklgiplivvdideefleal
00470361   1/1  ----------------------------------------------------------------------
00521171   1/1  gkkvvvllSGGvDSsvaaallkkagyeviavhfdyglrtdelcvseeeledakklaeklgiplivvdlde
00397821   1/1  ----------------------------------------------------------------------
00395381   1/1  vpvgvaLSGGvDSslvaalaaralgdvltftigfeg..ldeleearavaehlgtehhevlitvdallafl
00510381   1/1  ggkkvvvalSGGvDSsvllallakalglevlavtvdtglrseeeledarelaeklgiplhvvdidelfda
00462131   1/1  rdavrkrlvgdkkvvvalSGGlDSsvlaallkeaggaegllfmknwdlddevlavtvdygq..sdeleda
00507391   1/1  sglkgvvlGlSGGvDSalaaalavralgllrlergllnlnvlavtmpsglssd.sledakalaealgiel
00507461   1/1  kvlvalSGGvDSsvllallkkllkrlpgyelvavhvdhglrgesdeelefvrelaeklgiplivvdvdel
00399881   1/1  ----------------------------------------------------------------------
00494761   1/1  cleklnelledlvaeeilrealeefg.dkvvvalSGGkDSsvllhlllkaglevlavhvdtgllfpetle
00492981   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00483691   1/1  kvlvalSGGkDStvllhlllelarrllgfevvavhvdhglrgesdeelefvrelaeklgiplivvdldel
00488581   1/1  vpvgvlLSGGlDSslvaalaaralgnvlaftvgfgq..sdeleyarevaehlgiehhvvdideeelldal
00478481   1/1  kvvvalSGGlDSsvllallkealgyeviavtvdygqre..eleaarelakklgikphivvdldeeflsel
00502331   1/1  kvvvalSGGlDSsvalallkeagyeviavtvdlgqre..dleaarevakklgivplyvvdlseefaeevl
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  kvvvalSGGlDSsvllallkelgyeviavtvdlgqrhsedleaarevaeklgikehhvvdvdlefvedvv
00379031   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00501281   1/1  kvlvllSGGiDSpvaayllmkrGvevialhfdlgpltleealevvklllkll..................
00516451   1/1  rvvvsfSgGkDStvllhlalkalrpaglpipvvfldtgylfpetyefvdelaerlgldlivvrpdeslar
00468841   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00523631   1/1  kvvvlfSGGkDStlalylalelghevvalltllpeeldsymfhtvnlelaklqAealglpli--------
00433811   1/1  kvvvlySGGkDSslaLywllkkgyeVvalltlvgseldsymfhtvnlelaelqaealglpl---------


                         -         *         -         -         -         -         +:350
query           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGLPEDLEFEL
00479491   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00453911   1/1  idivdavdaflaalegvtgpepkdktigniqarlrmvalyalanklgalvlgt..gdvsEtllg.....y
00501381   1/1  ----------------------------------------------------------------------
00470351   1/1  aelfgptpnpcnlcnrlrlelllelakel.gadvlatGtgaddeietgyltllgddgikdlsyvlglpee
00470361   1/1  ----------------------------------------------------------------------
00521171   1/1  ifleilkkgetpn.pcvlcrrirlrillelaeel.gadviatGhnaddvadq..........tllnlyal
00397821   1/1  ----------------------------------------------------------------------
00395381   1/1  palagaldllepeakrkiipllllsraaregvkvvlsGegaDelfgGylyydvaesrallldllktlvdd
00510381   1/1  lldllgagdtpnpcnicrrlrlrllyelakelg.advlltG.hadelfegylllrgdglkg.........
00462131   1/1  revaeklGiphhvvdideeevldalkdvidagetpnpcvlcrrlrlyllyelarelg.advvltG.hgaD
00507391   1/1  lvvdidpavdallkllgeagpelkdltlgniqarlRmvllyalanllgglvlgT..gnlsElalg.....
00507461   1/1  flaagngpnpcalcrrlrygallelakel.....gadvlatGhhadDqaetvlln....llrgsglkglq
00399881   1/1  ----------------------------------------------------------------------
00494761   1/1  faeelaerlgiplivvdldeefaeflallgglsegdppnpcalcrrlklepllraakelg.adaiatGhr
00492981   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00483691   1/1  f....kglnpcalarrlryaallevar.......gadalatGhhldDqaetvllnllrgs...glkglag
00488581   1/1  pdvlaaldtpepvnlrsrirlylla...rlark..gakvvltGegaDelfgGyptyrpdplarlllldll
00478481   1/1  vdpaipagalyegnypltcvlcrnlifklllevaeelgadavatGhtaddlddv........rferlfla
00502331   1/1  dpalkayalgegpypltvvlarnlifkalleiakelgadaiatGhtlddndev...........rfelyf
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  ltlideykagatpegdypltcalarnliflllaelaeelg.adviatGhtlkgadelrfgy..lrlallp
00379031   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00501281   1/1  ...ekylcilckrlmlriaeklalklg.adaivtGeslgqvasq...........tlenlllidalnlpv
00516451   1/1  ggklwekdpd..wccdilkveplkralkelg.fdaw----------------------------------
00468841   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LEPFRLLFKDEVRELALLLGLPDTLRLRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
00479491   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00453911   1/1  ltkygdggld.......lrPlldlyKtevralarelglpeeiiekppsaeleplrpgqtdedslglpyri
00501381   1/1  ----------------------------------------------------------------------
00470351   1/1  lllklirPlldltkdevrelarelglpyaily--------------------------------------
00470361   1/1  --------------------------------GPGLavrvlgevteekleilreadaivleelrkaglyd
00521171   1/1  nallglkilrPLlgldKeeirelakelglpe..iskypsggcgscflprnpftkallelleeaeeildee
00397821   1/1  ----------------------------------------------------------------------
00395381   1/1  llvrvdrasmahglevrvPflDhrlvelalslppelklrggveKyl------------------------
00510381   1/1  ......irPlldlskeevrelarelglpeeilekppsadlgf.....gqldeellglpyeeldailevle
00462131   1/1  elfgGytkygdllkglaplgdlpkdqvyllarllg.llkreiralglelrvPfld---------------
00507391   1/1  yftkyGdggld.......iaPladlyKtevrelarylgipeeildkpPsaeLepltpgqtdedllgvtye
00507461   1/1  gillgglrlirPLldltkdeireyakelglp...viedpsnadllfir..nrirel--------------
00399881   1/1  ----------------------------------------------------------------------
00494761   1/1  rddsaerallrllrgd...............gglvvirP-------------------------------
00492981   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00483691   1/1  ikelaldgglrlirPLlelskeeirayakelglpyiedpsnydldfrrnrirhel---------------
00488581   1/1  tlllgvlllrvdrmsmahglevrvPfldhrlvefalslppelkpiggltKtllrelarelgllPeeilwr
00478481   1/1  llpelgviaplrpllglskaei------------------------------------------------
00502331   1/1  lallpglkiiaPlldlgllell------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  glelraplld..llfPllglskaeirela-----------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00501281   1/1  lrPLigldkeeiielareigt-------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
00479491   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00453911   1/1  ldlil-----------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00470361   1/1  kiwqafavllpvrsvGvqgdlrtygyvvvlravlsldamtadlaelplellekisnrilnevpgvnrvvy
00521171   1/1  glvlgl----------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------
00510381   1/1  lgehaglvs.ii----------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00507391   1/1  lldlilellgvl----------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00488581   1/1  pksgfg----------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           DLTSKPPATIEWE---------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00453911   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00470351   1/1  ----------------------------------------------------------------------
00470361   1/1  ditskPPatiewe---------------------------------------------------------
00521171   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00395381   1/1  ----------------------------------------------------------------------
00510381   1/1  ----------------------------------------------------------------------
00462131   1/1  ----------------------------------------------------------------------
00507391   1/1  ----------------------------------------------------------------------
00507461   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00494761   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00483691   1/1  ----------------------------------------------------------------------
00488581   1/1  ----------------------------------------------------------------------
00478481   1/1  ----------------------------------------------------------------------
00502331   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00399771   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00501281   1/1  ----------------------------------------------------------------------
00516451   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00523631   1/1  ----------------------------------------------------------------------
00433811   1/1  ----------------------------------------------------------------------