[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81530.1


[Show Plain Result]

## Summary of Sequence Search
   1::187
   1::177  2.7e-28 31.8% 0050442 00504421 1/1   iction endonuclease-like                
   1::187


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGEPARLRRLTAEEYLREEATSPVKRELVEGVPYAMAGAGRAHNLIVTNLVLLLGPLARRKGGRLYVADM
00504421   1/1  lllltllvrlTleeflalpetnpdlryElidGeliampppggehgrvqlrlialLllwledrglgvvfds


                         -         -         *         -         -         -         -:140
query           KLKVGEATFYYPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREKLWRYLSLPSLEGYLLVSARE
00504421   1/1  pllvrlpngnvrvPDvavvsgerlpalgseeregflplaPdlvvEvlSpstslkdlleKlllYlr.aGvk


                         +         -         -         -         -         *         -:210
query           RRVELYRKEGDILHQVAEEGEVPLPCLEGSLPVAEVYAGVELEGQEA-----------------------
00504421   1/1  lywlvdpeertvevyrlgqgvlvlladdtlsvsevlp---------------------------------