[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81541.1


[Show Plain Result]

## Summary of Sequence Search
   1::147
  65::146  2.9e-21 49.4% 0048152 00481521 1/1   lated DNA-protein cysteine methyltransf 
  66::148  5.4e-21 47.0% 0048993 00489931 1/1   lated DNA-protein cysteine methyltransf 
  66::147  1.5e-20 43.9% 0049380 00493801 1/1   lated DNA-protein cysteine methyltransf 
   1::147


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MWVPTPLGPLWLEVSPLGVRRLEPALYPRGPEAEGALALKVREAVQAYFAGERPDFLDLPLDYTGLSPAR
00481521   1/1  ----------------------------------------------------------------lgtdfq
00489931   1/1  -----------------------------------------------------------------gtdfq
00493801   1/1  -----------------------------------------------------------------gtdfq


                         -         -         *         -         -         -         -:140
query           LRLYERVRLVPYGRTVSYGALGRELGLSPRAVGAALRACPFFLLVPAHRVIHADGRLGGFQGQEGLKLWL
00481521   1/1  lrvwealleiPyGevvtYgelAkllglparaVglalganplallvPchRVvgsdg.lggyagglelkrll
00489931   1/1  lrvwealleiPyGevvtYgelAkllglpkaaraVglalganplailvPchRVvgsdgslggyagglelkr
00493801   1/1  qrvwealleiPyGkvltYgelAkllglpkaaRaVglalganplailvPchRVvgsdgslggyagglerkr


                         +         -         -         -         -         *         -:210
query           LRFEGAL---------------------------------------------------------------
00481521   1/1  lelEgv----------------------------------------------------------------
00489931   1/1  lllelEgv--------------------------------------------------------------
00493801   1/1  allelEl---------------------------------------------------------------