[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81546.1


[Show Plain Result]

## Summary of Sequence Search
   1::916
  75::249  3.7e-17 33.5% 0045060 00450601 1/1   nosyl-L-methionine-dependent methyltran 
  49::248  4.3e-17 31.5% 0050919 00509191 1/1   nosyl-L-methionine-dependent methyltran 
  77::236  9.9e-17 30.4% 0042197 00421971 1/1   nosyl-L-methionine-dependent methyltran 
  73::248    3e-16 27.4% 0046840 00468401 1/1   nosyl-L-methionine-dependent methyltran 
  75::251  1.6e-15 30.4% 0049074 00490741 1/1   nosyl-L-methionine-dependent methyltran 
  57::248  4.8e-15 29.8% 0050762 00507621 1/1   nosyl-L-methionine-dependent methyltran 
  77::248  4.8e-15 28.1% 0046838 00468381 1/1   nosyl-L-methionine-dependent methyltran 
  49::233  6.5e-15 32.1% 0051657 00516571 1/1   nosyl-L-methionine-dependent methyltran 
  81::247  6.9e-15 28.4% 0049532 00495321 1/1   nosyl-L-methionine-dependent methyltran 
  79::247    8e-15 29.1% 0049671 00496711 1/1   nosyl-L-methionine-dependent methyltran 
  58::248  1.4e-14 25.7% 0047386 00473861 1/1   nosyl-L-methionine-dependent methyltran 
  42::249  3.5e-14 28.2% 0046354 00463541 1/1   nosyl-L-methionine-dependent methyltran 
  53::249  4.1e-14 32.0% 0051842 00518421 1/1   nosyl-L-methionine-dependent methyltran 
  77::236  4.5e-14 31.5% 0047851 00478511 1/1   nosyl-L-methionine-dependent methyltran 
  80::244  5.9e-14 30.9% 0043085 00430851 1/1   nosyl-L-methionine-dependent methyltran 
  25::247  7.2e-14 22.8% 0049885 00498851 1/1   nosyl-L-methionine-dependent methyltran 
  39::240  1.9e-13 31.1% 0050745 00507451 1/1   nosyl-L-methionine-dependent methyltran 
  55::235  2.3e-13 27.8% 0046744 00467441 1/1   nosyl-L-methionine-dependent methyltran 
  58::249  2.9e-13 29.2% 0053077 00530771 1/1   nosyl-L-methionine-dependent methyltran 
  48::248  3.1e-13 25.5% 0041580 00415801 1/1   nosyl-L-methionine-dependent methyltran 
  70::251  6.4e-13 25.6% 0047676 00476761 1/1   nosyl-L-methionine-dependent methyltran 
  84::236  6.8e-13 28.2% 0050935 00509351 1/1   nosyl-L-methionine-dependent methyltran 
  82::261  7.3e-13 29.9% 0049915 00499151 1/1   nosyl-L-methionine-dependent methyltran 
  54::247  7.9e-13 30.6% 0040196 00401961 1/1   nosyl-L-methionine-dependent methyltran 
  58::247  9.7e-13 26.0% 0040327 00403271 1/1   nosyl-L-methionine-dependent methyltran 
  57::243  1.1e-12 25.1% 0046696 00466961 1/1   nosyl-L-methionine-dependent methyltran 
  81::247  1.2e-12 31.5% 0047471 00474711 1/1   nosyl-L-methionine-dependent methyltran 
  55::248  1.3e-12 29.8% 0041444 00414441 1/1   nosyl-L-methionine-dependent methyltran 
  68::240  1.3e-12 29.4% 0051449 00514491 1/1   nosyl-L-methionine-dependent methyltran 
  66::253  1.4e-12 25.1% 0051103 00511031 1/1   nosyl-L-methionine-dependent methyltran 
  74::210  1.4e-12 28.4% 0049474 00494741 1/1   nosyl-L-methionine-dependent methyltran 
  83::239  1.6e-12 32.8% 0048490 00484901 1/1   nosyl-L-methionine-dependent methyltran 
  82::248  2.1e-12 31.0% 0049122 00491221 1/1   nosyl-L-methionine-dependent methyltran 
  57::242  3.8e-12 23.9% 0047329 00473291 1/1   nosyl-L-methionine-dependent methyltran 
  78::247    5e-12 28.6% 0050988 00509881 1/1   nosyl-L-methionine-dependent methyltran 
  58::241  5.5e-12 29.9% 0047580 00475801 1/1   nosyl-L-methionine-dependent methyltran 
  51::248  5.9e-12 26.7% 0052709 00527091 1/1   nosyl-L-methionine-dependent methyltran 
  78::242  6.3e-12 28.6% 0049719 00497191 1/1   nosyl-L-methionine-dependent methyltran 
  77::247  6.5e-12 28.8% 0047919 00479191 1/1   nosyl-L-methionine-dependent methyltran 
  77::237    7e-12 28.2% 0052649 00526491 1/1   nosyl-L-methionine-dependent methyltran 
  60::207  9.6e-12 28.5% 0047923 00479231 1/1   nosyl-L-methionine-dependent methyltran 
  78::244  1.1e-11 33.8% 0050234 00502341 1/1   nosyl-L-methionine-dependent methyltran 
  59::240  1.4e-11 28.2% 0052807 00528071 1/1   nosyl-L-methionine-dependent methyltran 
  80::241  1.5e-11 31.0% 0051143 00511431 1/1   nosyl-L-methionine-dependent methyltran 
  55::249    2e-11 28.7% 0051239 00512391 1/1   nosyl-L-methionine-dependent methyltran 
  76::239  2.1e-11 30.0% 0051823 00518231 1/1   nosyl-L-methionine-dependent methyltran 
  42::249  2.4e-11 31.1% 0051679 00516791 1/1   nosyl-L-methionine-dependent methyltran 
  79::241  3.4e-11 29.0% 0046931 00469311 1/1   nosyl-L-methionine-dependent methyltran 
  54::248  4.2e-11 28.7% 0047211 00472111 1/1   nosyl-L-methionine-dependent methyltran 
  83::235  4.4e-11 27.4% 0047945 00479451 1/1   nosyl-L-methionine-dependent methyltran 
  57::227  5.5e-11 26.5% 0048438 00484381 1/1   nosyl-L-methionine-dependent methyltran 
  57::249  5.8e-11 31.2% 0050242 00502421 1/1   nosyl-L-methionine-dependent methyltran 
  70::248    7e-11 30.1% 0049171 00491711 1/1   nosyl-L-methionine-dependent methyltran 
  77::267  7.8e-11 29.3% 0051885 00518851 1/1   nosyl-L-methionine-dependent methyltran 
  35::207  1.9e-10 29.1% 0052182 00521821 1/1   nosyl-L-methionine-dependent methyltran 
  34::241  2.4e-10 28.3% 0051930 00519301 1/1   nosyl-L-methionine-dependent methyltran 
  23::254  3.4e-10 31.9% 0051261 00512611 1/1   nosyl-L-methionine-dependent methyltran 
  71::207  3.5e-10 27.4% 0052001 00520011 1/1   nosyl-L-methionine-dependent methyltran 
  65::234  3.6e-10 29.7% 0045109 00451091 1/1   nosyl-L-methionine-dependent methyltran 
  82::246    4e-10 28.6% 0044689 00446891 1/1   nosyl-L-methionine-dependent methyltran 
  75::206  5.1e-10 28.6% 0051617 00516171 1/1   nosyl-L-methionine-dependent methyltran 
  49::243    7e-10 23.0% 0041326 00413261 1/1   nosyl-L-methionine-dependent methyltran 
  57::239  1.4e-09 29.8% 0050154 00501541 1/1   nosyl-L-methionine-dependent methyltran 
  55::233  3.6e-09 28.0% 0047656 00476561 1/1   nosyl-L-methionine-dependent methyltran 
  71::231  5.3e-09 29.6% 0035026 00350261 1/1   nosyl-L-methionine-dependent methyltran 
 444::662  9.5e-09 22.2% 0048648 00486482 2/3   ike                                     
  75::233  1.6e-08 30.5% 0040829 00408291 1/1   nosyl-L-methionine-dependent methyltran 
  50::248  1.7e-08 26.9% 0052536 00525361 1/1   nosyl-L-methionine-dependent methyltran 
  51::249  2.2e-08 26.1% 0050749 00507491 1/1   nosyl-L-methionine-dependent methyltran 
  83::243  2.5e-08 25.7% 0048629 00486291 1/1   nosyl-L-methionine-dependent methyltran 
  54::227  4.1e-08 29.7% 0044550 00445501 1/1   nosyl-L-methionine-dependent methyltran 
 505::733  7.2e-08 28.9% 0052100 00521002 2/2   ike                                     
  77::207  8.2e-08 32.2% 0050519 00505191 1/1   nosyl-L-methionine-dependent methyltran 
  55::261  1.2e-07 24.2% 0039093 00390931 1/1   nosyl-L-methionine-dependent methyltran 
  43::236    2e-07 24.7% 0037982 00379821 1/1   nosyl-L-methionine-dependent methyltran 
 496::778  2.3e-07 33.6% 0047366 00473662 2/2   ike                                     
  54::239  3.1e-07 26.2% 0053107 00531071 1/1   nosyl-L-methionine-dependent methyltran 
  52::211  4.8e-07 23.0% 0052618 00526181 1/1   nosyl-L-methionine-dependent methyltran 
 634::732  6.6e-07 34.3% 0047256 00472564 4/4   ike                                     
 332::533  1.8e-06 30.7% 0051642 00516422 2/3   ike                                     
 504::756  2.9e-06 23.8% 0046495 00464952 2/2   ike                                     
 258::401    3e-06 25.4% 0048699 00486991 1/3   ike                                     
  84::247  4.6e-06 27.5% 0051944 00519441 1/1   nosyl-L-methionine-dependent methyltran 
 267::382  4.8e-06 32.8% 0052100 00521001 1/2   ike                                     
 666::770  5.6e-06 31.4% 0039276 00392764 4/4   ike                                     
 442::583  6.7e-06 24.6% 0047832 00478321 1/2   ike                                     
  53::247  8.4e-06 27.4% 0047465 00474651 1/1   nosyl-L-methionine-dependent methyltran 
  55::247  1.1e-05 26.9% 0036610 00366101 1/1   nosyl-L-methionine-dependent methyltran 
 266::385  1.4e-05 27.4% 0046495 00464951 1/2   ike                                     
 265::383  1.5e-05 30.3% 0051240 00512401 1/3   ike                                     
  90::249  2.5e-05 28.7% 0053229 00532291 1/1   nosyl-L-methionine-dependent methyltran 
  44::235  2.8e-05 25.7% 0048805 00488051 1/1   nosyl-L-methionine-dependent methyltran 
  76::207  2.9e-05 31.6% 0052982 00529821 1/1   nosyl-L-methionine-dependent methyltran 
 256::382  3.2e-05 26.8% 0040251 00402511 1/3   ike                                     
  73::237  3.5e-05 27.5% 0042682 00426821 1/1   nosyl-L-methionine-dependent methyltran 
 264::380    4e-05 32.5% 0052646 00526461 1/3   ike                                     
  54::207  5.6e-05 28.6% 0051840 00518401 1/1   nosyl-L-methionine-dependent methyltran 
 510::778  5.8e-05 27.0% 0050358 00503582 2/2   ike                                     
  96::234  9.1e-05 31.7% 0040964 00409641 1/1   nosyl-L-methionine-dependent methyltran 
 300::382  0.00011 42.2% 0052670 00526702 2/4   ike                                     
  88::249  0.00012 28.7% 0046568 00465681 1/1   nosyl-L-methionine-dependent methyltran 
 605::757  0.00016 26.8% 0052670 00526704 4/4   ike                                     
  60::235  0.00018 27.7% 0052894 00528941 1/1   nosyl-L-methionine-dependent methyltran 
  75::207  0.00019 22.3% 0053087 00530871 1/1   nosyl-L-methionine-dependent methyltran 
 503::607  0.00024 24.0% 0048699 00486992 2/3   ike                                     
 583::729  0.00024 25.9% 0051642 00516423 3/3   ike                                     
 266::354  0.00025 37.1% 0039276 00392761 1/4   ike                                     
 659::769  0.00026 30.6% 0040251 00402513 3/3   ike                                     
  96::228  0.00037 36.1% 0051884 00518841 1/1   nosyl-L-methionine-dependent methyltran 
 661::765  0.00039 31.4% 0045692 00456923 3/3   ike                                     
 655::779   0.0004 30.9% 0052646 00526463 3/3   ike                                     
  58::215  0.00046 27.6% 0047303 00473031 1/1   nosyl-L-methionine-dependent methyltran 
 506::605  0.00062 29.3% 0052646 00526462 2/3   ike                                     
  34::246  0.00063 28.2% 0049442 00494421 1/1   nosyl-L-methionine-dependent methyltran 
 277::377  0.00083 36.4% 0045692 00456921 1/3   ike                                     
 631::751   0.0012 22.3% 0051037 00510372 2/2   ike                                     
 508::607   0.0016 30.9% 0040251 00402512 2/3   ike                                     
 450::647   0.0025 23.2% 0042932 00429322 2/3   ike                                     
 493::607    0.003 28.6% 0047256 00472563 3/4   ike                                     
 651::776   0.0056 29.4% 0042932 00429323 3/3   ike                                     
 264::384     0.01 33.1% 0042932 00429321 1/3   ike                                     
 648::768    0.014 30.8% 0051240 00512403 3/3   ike                                     
 676::764    0.014 25.3% 0048648 00486483 3/3   ike                                     
 252::354    0.015 41.0% 0047256 00472561 1/4   ike                                     
 266::380    0.034 24.3% 0048732 00487321 1/2   ike                                     
 499::605     0.06 26.9% 0045692 00456922 2/3   ike                                     
 286::382    0.067 30.5% 0050358 00503581 1/2   ike                                     
 623::763    0.083 24.6% 0047832 00478322 2/2   ike                                     
 298::384    0.085 26.4% 0047366 00473661 1/2   ike                                     
 700::768     0.22 27.3% 0049644 00496442 2/2   ike                                     
 673::768     0.24 22.9% 0048732 00487322 2/2   ike                                     
 274::327     0.39 38.9% 0051642 00516421 1/3   ike                                     
 295::374     0.42 31.2% 0049644 00496441 1/2   ike                                     
 658::787     0.46 29.2% 0048699 00486993 3/3   ike                                     
 489::559        1 25.4% 0039276 00392763 3/4   ike                                     
 470::553      1.2 26.5% 0051240 00512402 2/3   ike                                     
 277::382      6.3 35.8% 0051037 00510371 1/2   ike                                     
 260::293      7.8 35.3% 0052670 00526701 1/4   ike                                     
 272::382       11 27.0% 0048648 00486481 1/3   ike                                     
 362::382       11 42.9% 0039276 00392762 2/4   ike                                     
 388::586       35 22.3% 0052670 00526703 3/4   ike                                     
 360::382       37 34.8% 0047256 00472562 2/4   ike                                     
   1::916


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPDELRLFLKERFGVQGPLSPGRFEAELAKRLGSPARRAPLLKAWRAYLAQGGREAVRSFYREVLKVPKG
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ------------------------------------------------klleleedvrslfldyaelydg
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  --------------------------------------------------------veehyde..laefy
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ------------------------------------------------pedevkelirsfydraadrydg
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ---------------------------------------------------------melfdevaerydd
00463541   1/1  -----------------------------------------renlvdnlaehy.dllnevleallkvpre
00518421   1/1  ----------------------------------------------------Mkekvkeyyde..laery
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ------------------------darlllglllglslllleayldlvldeeelerllellerlaerypl
00507451   1/1  --------------------------------------llvlllllllalnkalkllrdllrklglpayr
00467441   1/1  ------------------------------------------------------ikrlvvllvlkgllls
00530771   1/1  ---------------------------------------------------------keyydeiaery..
00415801   1/1  -----------------------------------------------mekkelldwiaelldlgldlykl
00476761   1/1  ---------------------------------------------------------------------l
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  -----------------------------------------------------keavaeyydlf...adf
00403271   1/1  ---------------------------------------------------------dgdsllplvllel
00466961   1/1  --------------------------------------------------------dlsndlyelyldly
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ------------------------------------------------------tysagyydlpad....
00514491   1/1  -------------------------------------------------------------------Gad
00511031   1/1  -----------------------------------------------------------------kllel
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  --------------------------------------------------------vkllkegdrvllel
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ---------------------------------------------------------lafldlplafgeg
00527091   1/1  --------------------------------------------------qnhYDlsndfyelfldpsmt
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  -----------------------------------------------------------efydd..yals
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------fdsyayfydaln
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ------------------------------------------------------elydklaefYdkllg.
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  -----------------------------------------vlgnddyqeefdpealadefy...alase
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  -----------------------------------------------------nsdmsddefdpkkylde
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  --------------------------------------------------------seildglvivgkyd
00502421   1/1  --------------------------------------------------------dvkdfydelaely.
00491711   1/1  ---------------------------------------------------------------------s
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------diteeelleyvlrhsfvpdpllllalrdealdvggg
00519301   1/1  ---------------------------------vllslfaerlvealkllkklllkglvnayrlvlgegd
00512611   1/1  ----------------------ellealnrklpltlrvntlkisreeilkhy..dlagkvydlfyivprg
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------ddlakf
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ------------------------------------------------rskrvpleyilgeadfyglpld
00501541   1/1  --------------------------------------------------------dvaeyfddiaavyd
00476561   1/1  ------------------------------------------------------dlyndlfelfldhsse
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  -------------------------------------------------lkvdkeeiakfydlaaeyydl
00507491   1/1  --------------------------------------------------egeplriilgkleglklkld
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  -----------------------------------------------------drveppcphfgecggcq
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ------------------------------------------------------eeffelfrdigkkydg
00379821   1/1  ------------------------------------------melveklkedgvivvedvldafrlvskn
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  -----------------------------------------------------Gplriilgefrglklkv
00526181   1/1  ---------------------------------------------------lqeitedllellfnallll
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------leddllplliryslpdwl
00366101   1/1  ------------------------------------------------------mserliklepekyill
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  -------------------------------------------vnvlkidseevleallkegrellltpg
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  -----------------------------------------------------qvmlklikkqikeypqd
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  -----------------------------------------------------------ylgdydklrll
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ---------------------------------------------------------prellkeflkakk
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ---------------------------------lpgllidrliqllgeelealleallealplllrvntl
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EALVYGMHLPHLEFYAKELPPRVEGRVLEVGAFTGALVGFLQRKRPDLEWHALDGVEEAVALGKKRVPEV
00450601   1/1  ----MssteklsplliehkelveefydslaerydelrgvllrpaqrallelllellgllpgkrvLDvGCG
00509191   1/1  dnllleelgdgvmraqeralmallallglrpggrVLDvGcGtGglalalaeagpe.evtgvDispemler
00421971   1/1  ------Msdcplcpesltpsellykeevarvfdriaerydrlrpvpsplyyllgddeeayldlllfpgag
00468401   1/1  --lslapllllllddvlleawlslldallegrldllellyglglfeylaldaevydafldglrpatelll
00490741   1/1  ----ledllrayllllpellllleslenladhldlgnppfelllgeeffeyfakvyelydafndglrpat
00507621   1/1  dkllgelliprpateellelllellglkpgkrvLDlGCGtGrlalalakrgp..evtgvDispemlelAr
00468381   1/1  ------edsllplllllldpllleallslleallegkydllellfgkelfeylagdaelydlfndglrpg
00516571   1/1  qnrlleelgdgvmlaqerallrllallglrpggrvLdvGcGtGllalalaeagp.aevtgvDispemler
00495321   1/1  ----------tigellrealalleeagldlldaelllllllgldrlrlllllllplsvlellllleller
00496711   1/1  --------nsvsglfdsiashydllndlyellldedyfysygyfddyglglrpaqeallelllellglkp
00473861   1/1  fadglspgqdrllelllellaellkpgkrvLDiGcGtGglalalakllgepgarvtgvDispemlelare
00463541   1/1  lflpevplrelayedeflpitlevgegllisqpetlalllellglkpgkrvLDiGcGtGylalalarlgg
00518421   1/1  dllrgslplrpaaealldlllellp..pggrvLDlGcGtGrlalalaerga..evtgvDispemlevare
00478511   1/1  ------klkksfdnvakhYdlgndlyslildpdmfysygyyddpdetlrpaqelllelllellglkpgkr
00430851   1/1  ---------msetetdfglarlklieeliashydlsvdvlealldvpreyfvlepayedlalafgtgvhi
00498851   1/1  lksllselndrdweeaylkglrpfrgldflvipavldprpdgerlvldpglffgtglhpttelllellak
00507451   1/1  lvlgegdllrglavdrygdwlvvlllselgleelealleallellppidlrvnklkisreelgepvelll
00467441   1/1  rlladalilvprhydlgedlygeelakvyddlaafldg...lrsrqeallelllellglkpgkrvLDlGc
00530771   1/1  ....dpaqrallelllellgllpggrvLDlGCGtGrlalalarrga..rvtgvDlspemlelareraaaa
00415801   1/1  eaellldevlgldraglllgdrgltleelakflelierrlegepleyllglyeflglefgtgpgvfiprp
00476761   1/1  ldllsllllelglvlsdeqleklealldllldwnpvinltgsrefdelwlrvlldllallplkpgkrvLD
00509351   1/1  -------------nmllelllklllllglnlseeqyekledyfdllldwnkkynllsskdpdrlwerhil
00499151   1/1  -----------Llvlgllielltpglrlllkvdelllserskyqeirvyelgddgrvllldgllqgssld
00401961   1/1  ydllldpnfhysygyfsgefldleeaqerlldlllellglkpgkrvLDvGCGtGglllalakryg.arvt
00403271   1/1  sdellrafldllealregepafelafgkdffeylakdpdlalrflggmralsellldellealpdlsggk
00466961   1/1  dlyssaydllgdrpltdalleallellglkpgkrvLDlGcGtGglalalakrgak.rvtgvDisp.mlel
00474711   1/1  ----------ldgwfteilwpglrlllkldellheekskyqiiriydlgndgrvllldglvlgsrpdeaq
00414441   1/1  ..ilrpateelldlllellglkpgdrvLDlGcGtGglalalaravg.arvtgvDispemlelareraeel
00514491   1/1  eyfefgpryiqepllelllelldlllkpgkrvLDiGcGtGglalalakllpgakvtgvDispemlelare
00511031   1/1  ldldidllklsllklkkinklyknlknlilkntsnvskeeiakfydlvadffdevaayydglfgdllslr
00494741   1/1  ---kngikdeilldyilsrprgepldelldeyedyalkfglglliiqpellalllelldlkpgkrvLDiG
00484901   1/1  ------------lllldkllkllkpgdlvllllannlllpltlrvnklkltrfgllnvlelsgknavahy
00491221   1/1  -----------mstvplselskklaeeffydlaadfydllldglfpsqrelldlllellglkpgkrvLDl
00473291   1/1  grplmllellregglldtrlgiepledllgvprglfldlavgylvlilrpltedlveafgrgtqitqpav
00509881   1/1  -------kalldillwliellslglalslkidklleeekskyqiiriydlgnfgyelfldgrllysrlde
00475801   1/1  vlisqpellalllelldlkpgd...rvLDiGcGtGylalalaklvg.grvtavdispealelarenaerl
00527091   1/1  yssgyfedpgesleeaqeakldllldklglkpgkrvLDiGCGtGglarylaeryg.arvtGiDlseemle
00497191   1/1  -------llllralllllelvelllelleklldsllkgeipfeyllgedffeyfdddaelydgfndglsg
00479191   1/1  ------YdlgndlyellldedyfysdayyddpgdllrpaqerllelllellglkpgkrvLDiGcGtGgla
00526491   1/1  ------ddlyddglsliqrellelllelldlllkpgkrvLDiGcGtGglalalakllpgakvtgvDispe
00479231   1/1  fdeglrptqeellelllellglkpgkrvLDlGcGtGglalalaklgp..kvtgvDispealelarenake
00502341   1/1  -------al.klelllellglkpgkrvLDiGcGtGglalalakrg..arvtgvDispemlelareraael
00528071   1/1  llql.rprtealleallellglkpgkrvLDlGcGtGglalalakrgak.rvtgvDisp.mlelarenaae
00511431   1/1  ---------qrellelllellglkpgkrvLDiGcGtGglalalakrgp..rvtgvDispemlelareraa
00512391   1/1  ......srllyeelldlllellpelllkgkrvLDlGCGtGrltlalakrga..kvtgvDiseemlevAre
00518231   1/1  -----idcallaerlnkalellkdllkklevlrlilregdglpglavdrygdwlvvlllealgeeeleel
00516791   1/1  ydpldrllllllerllellslglkpggrvLDvGcGtGllalllaarlga.rvtglDlspamleearkrla
00469311   1/1  --------erlfdeyaefydlanglglrprqeallelllellplkpgkrvLDlGcGtGglalalaklgpk
00472111   1/1  fyddyagrffrlr...eilrllldellallgllpggrvLDvGcGtGllalalaralppgarvtgvDlspe
00479451   1/1  ------------etlgellklrlnklikeefdlgnkfsklwldrsvydsyyfeakllglyrsraalklee
00484381   1/1  lskdlfeeflgdydlvlafldglrsraerllelllellglkpgkrvLDlGcGtGglalalakllgagrvt
00502421   1/1  .ddlldelsdalldlllellglkpgkrvLDiGcGtGglalal......grvtgvDispemlelarer..n
00491711   1/1  kyywdefyrplldallellglkpgkrvLDlGCGtGglllalarl.gagevtGvDiseemlelArerakea
00518851   1/1  ------eldgqlldlllklikeklkknlglnldllplgegqyieelwpglalslkvdevlhekkskyqii
00521821   1/1  lpilspekgalllellrllpgk...rvLdiGtGtGysalalaralppgarvvavdispealalarenlea
00519301   1/1  llrglavdrypdwlvvlllsalgeeelealleallellpdlrvnllkisreeklllrreeilpllpetll
00512611   1/1  efllldptledsvlifkrgteilqpadlalilellglkpgdrvLDiGcGsGgltlalarlvgpegrvtav
00520011   1/1  llletliellldlgrdllldervddylrdlikglpeallaledfadllykyaylfswrgrliiklpedga
00451091   1/1  lgqnfltdpellelilellnlkpgdtvLDiGcGtGaltlalaklgp..kvtgvdiseemlelakenlken
00446891   1/1  -----------lalllelldlkpgkrVLDiGcGtGyltlllaklgg..kvtgvDiseemlelarenlken
00516171   1/1  ----QnfltdpalldailellglkpgdrVLDiGcGtGaltlalakrga..rvtgvDispemlelareraa
00413261   1/1  vggafltprpitellleallelgllkgkrvLDlGcGtGilaialakl.GaakvtavDispealelarena
00501541   1/1  gfaeglreaaeallelllellp.pgkrvLDiGcGtGglalalakr..garvtgvDispemlelareraae
00476561   1/1  yalinqllleelvellldlldlkpglkvLDiGcGtGelalalakklpalfpsigakvtgvDiseemiela
00350261   1/1  nvTsffrdpehfdalaelllpllpglrvLdlGcGtGeepyslamlllealalagpgarvtatDispeale
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----vlipfehqevlleellellklkpgkrvLDlGcGtGglalalakllpgarvigvDispealelaren
00525361   1/1  vyatedgylgglflfngadleesaefladlllellgllpgkrvLDvGcGtGrltlallarlga.evtgvD
00507491   1/1  pgqafltprpvtellvdallelgllkgkrvlDlGaGtGalslalakr.gakkvvavDidpealelarena
00486291   1/1  ------------sydniaihydmlndrprtealleallellgllkgkrVLDvGcGtGilslalakaGak.
00445501   1/1  lqhlsyeaqlelkknlleellkrlgptifsplplgyrnkaelvvrvdlkgdglglgfyekgskilvriee
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ------lHipvlleellellapkpggrvlDlgcGtGghslalaerg..grvigvDidpealalarerlag
00390931   1/1  wyfeepllpglalsykvdrvlhegkspyqeililespdfgrllvldgvvqlserleliyhealahlllll
00379821   1/1  lflgervygegvvkpqdegatiwaphrsrlaaklaeilelldlkpGdrVLDlGcGtGgltlhlaklvgpe
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  dpgvlirpttd.rlrelllelladllkgkrvLDlgcGtGglalalak.rgakkvtgvDispealelaren
00526181   1/1  ienlldgaldalleilpellgllflldlllddellrelldllseidlseidydilgelyeyllgefaglr
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  -------------slprwlvinllkllgeellealleallellplvlrvnellaelgielerdelgppll
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  vellldllgeeleallealllplpldlrvntlkisleellelleklgvvleaydllgdpleyllglrefy
00366101   1/1  elkflglrfkvdpgvffptgldldtelllelldlkkgkrvLDlGcGtGilaialakrga..kvtgvDisp
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  -------------------lllgllwltetltpglalslkvdevlyeekspyqeivvvesgdfgrllfld
00488051   1/1  lvpgksvygedygdplgeearlwdprrsrlaaklalilellglkpGdrVLDlGcGsGgltlhlaelvgpe
00529821   1/1  -----vsidfvrrflvkliekiilrswrgldiilsagylipgilgregteqlldsalilemlqelkglsv
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  --qnfltdpeilekilelldlkegdrvLdiGcGtGaltlelakrgg..kvtaieideemlelakenlkel
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  klvripekaslyllvlealltglnllqrllaafllelldlfkgkrvLdiGaGtGllllalaellppgaev
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  -------------------------rVLdiGcGtGglarellkh.gaaevtgvdidpevielakenlkln
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  -----------------gyvsrgalklqelleklgllkpgervLDlGcGpGgltlvlaervgpggrvvav
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  rsnlaeqllslla.......lrrglrilDlGcGtGalllalaevlppdvrvvgvDiseealekarqrlga
00530871   1/1  ----fyTPreivellvelldpkpggrvlDpgcGsGgfllalaerllpgarvvgvDidpealelaren...
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  -------------------------rVLDiGtGsGgltlllarlvgpkGrVigvdiseemlelarenlkr
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  slgqnfltdpnladkivelldllpgdlnleglrvLeiGcGtGaltlaLlkrlgak.kvtavEidpdmiei
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  kisldellelleglgielrllpllplayilgerlefallpgfktglfltqrevsellaelldlkpgerVL
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           AWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPEAFWKRFAFFERLPLFARLLRPGGLLVYGHG
00450601   1/1  tGllslalaer.ga.eVtgvDiseemlelAreraaengldpgadnvefvvgdaedlpellfpdgsfDlvv
00509191   1/1  areraaelgpnvrvlvgdaeellpplpdgsfDavlsDppgssevlhhvpd..................le
00421971   1/1  iprplaelllelldelllkpgkrvLDiGCGtGylalalakllPgarvtgvDispemlelAreragnvefi
00468401   1/1  dlllellglkpgkprvLDiGcGtGglalalakrlPgarvtgvDi.pemlelarer.pnvefvvgDaed.p
00490741   1/1  rlllelllellglkpgkrvLDiGcGtGglalalakalPgarvtgvDi.pemlelarenaaelglspnvef
00507621   1/1  erakenglnvefiqgDaedlpfdgsfDlvvsnpnvlhhl.ppedl...............ekllrelarv
00468381   1/1  serlldlllellpllkpgkrvLDiGcGtGglalalakalPgarvtgvDi.pemlelarer.pnvefvvgD
00516571   1/1  areraaeagpnvrvlvgdaedllpplpdgsfDavlsDppsevlhhvrr......................
00495321   1/1  rllgepveyllgerefyglafkvgggvftprpttelllelllellp.kpgkrvLDlGcGtGglalalakl
00496711   1/1  gkrvLDiGcGtGglalalakalg.arvtgvDispemlelarenaaelglpnrvefvvgDaedl.dgsfDl
00473861   1/1  raaelglsdnvefvvgDaedlplpdfDlvvsnavlhhlpdpdl................eallrelarvL
00463541   1/1  pdgrvvavDispealelarenaerlgldnvefilgdaedllfedgsfDlvvsdapleh............
00518421   1/1  r.gnvefvvgdaedlpfpdgsfDlvvssfgvlhhl.pdp.................eaalrelarvLkPG
00478511   1/1  vLDiGCGtGllalalakrvga.rvtgvDispemlelarenakenglpnrvefivgdaedld.gsfDlvvs
00430851   1/1  lrpellalllellledlkpgarVLDiGcGsGyltlalarlvpelgkdpggrvvgvDispealelarenle
00498851   1/1  llkpgdrVLDlGcGtGtlaialaklga..rvtgvDispealelArenaarngldnvefvqgdaedlpdgs
00507451   1/1  gelpeelyvqflglkfkvdpgvffrpgte.llvelllelldlkpgkrvLDlGcGtGglalala..rpgak
00467441   1/1  GtGglalalakllgagrvtgvDispealelarenaaglpnvefivgDaedplpdlleegsfDlvvsd...
00530771   1/1  gldnvefvvgdaedlpfdgsfDlvvsngvl................hhlppedleallaelarvLkpGGr
00415801   1/1  ttelllelllellglkpgkrvLDlGcGsGllaialak.lgaakvtgvDispealelArenaelnglsnrv
00476761   1/1  lGcGtGllalalakllpgarvtgvDispealelarenaaelgldnvefvvgdaedlppdgsfDlvvsnpp
00509351   1/1  dsllllelldlkpgkrvLDlGcGtGllaialaklfpgakvtgvDispemlefarenakklgldnvefiqg
00499151   1/1  erqrallllllallglkpgkrvLDiGcGtGglalalakr.pegarvtgvDispealelarenlaelglgl
00401961   1/1  GiDispemlelareraaelglpnrvefvqgdaedlp.dsfDlvvsnevlhhlgpedlea...........
00403271   1/1  rvLDvGcGtGalllalakkyPgakvtgvDlsp.mlelaren.prvefvvgDafd.plpsfDlivsswvl.
00466961   1/1  arenaaenglpnrvefivgDaedlplpdgsfDlvvsnpsgvlhhl.pd................eleall
00474711   1/1  erllllllallplkpgkrvLDiGcGtGglalalakrgpdarvtgvDispealelarenlalnglelglpn
00414441   1/1  glpdnvefvvgDaedl.fpdgsfDlvvsngvl................hhlpd..peallrelarvLkpG
00514491   1/1  nakelglpnvefivgdaedlpellpdgsfDlivsnpPyp.sgvlhhlpdpl..........lqeellkel
00511031   1/1  paqeellelllellplkpgkrvLDiGcGtGglalalakrlga.rvtgvDispemlelarenaaelglvef
00494741   1/1  cGtGglalalakllppgakvtgvDispealelarenakenglpnrvefivgdaedflpfllaeglldgsf
00484901   1/1  dlsndvyellldpaysdslarfgegntllqpelaelllelldlkpgkrvLDiGcGtGglalalakllgpd
00491221   1/1  GcGtGglalalakr.ga.rvtgvDispemlelarenaaelglsdaddnvefivgDaedlplpellledgs
00473291   1/1  aalllellglkpGarVLDlGcGtGaltlalaravgpggrvvavDispealelarenlaraglalpdnvev
00509881   1/1  aqytelllllllldlkpgkrvLDiGcGtGglalalakrgpaakvtgvDispealelarenlkelglsldd
00475801   1/1  gldnvevilgdaeellfedgsfDlvvsdaplph........................lleellrlLkpGG
00527091   1/1  rareraaeaglsnrvefivgdaedlp.gsfDlvvsievl................ehvgpedleaflkel
00497191   1/1  aqelllelllellplkpgkrvLDiGcGtGglalalakalpgakvtgvDi.pemlelarenakelglpnrv
00479191   1/1  lalakalg.arvtgvDispemlelareraaelglpnrvefvvgDaedld.gsfDlvvsnavlhhlpledl
00526491   1/1  mlelarenakelglpnvefivgDaedlpellpdgsfDlivsnpPypw............pgvlhhlpdel
00479231   1/1  lglddnvefivgDaedlplpdgsfDlivsdpplhhlpd.....................llkellrl---
00502341   1/1  glpnvefvvgDaed..lpfpdgsfDlvvsnavlhhlpdpe.......................allrela
00528071   1/1  nglpnrvefivgDaedlplpdgsfDlvvsnplpfvlhhlp.........dleallreaa.........rv
00511431   1/1  elglpnvefvvgDaedlpfpdgsfDlvvsnavlhhl.pdp.................eallrelarvLkP
00512391   1/1  rakeaglnvefivgdaedlpfdgsfDlvvsnfnvl...............hhllseedlekalkeiarvL
00518231   1/1  leallellpelrvnllkisredlleelldelielllgerdllgelyenglrflvdpdgfgtglfptqell
00516791   1/1  elgladdwsplvkvvcelegklllleeleellrdlvnvelvvgdaedlplpdellgsfDlvvssfvle..
00469311   1/1  .rvtgvDisp.mlelarenaaenglpnrvefivgDaedlleplpdfDlvvsnPpggvlhhlpd.......
00472111   1/1  alelarerlaeaglafdwspllkvvlelegnlelleeleellradrvrfvvgdaedlppllalplpdgsf
00479451   1/1  lleklglkpgkrvLDlGCGtGglalylakrypgakvtgvDispemlelaren.krlgldnvefiqgvdal
00484381   1/1  gvDispealelarenakrlgnvefivgDaedlldlplpdgsfDlvvsd...lphlpdp............
00502421   1/1  vefvvgdaedlpfpdgsfDlvvssavlhhlpdpea.......................llrelarvLkPG
00491711   1/1  glsdnvefivgdaedlpefpdgsfDlvvsnfvl...............hhlflspedleaalreiarvLk
00518851   1/1  riydlgndgrrlfldggvqysrlderqleelllllalldlkpgkrvLDlGcGtGglalalakrgpdarvt
00521821   1/1  aGledrvtvilgdaedllpqllaplpdgkfDlifldapl..................ehlpdllell---
00519301   1/1  eeflglrfkvdpgvffqtglfptqelllelllell..kpgkrvLDlGcGtGglalalakl.gakkvtgvD
00512611   1/1  DiseealelarenlerlglddnveviqgDaed.plpdgsfDaivs......dlpdpw.............
00520011   1/1  llrlllaelkpk...riLElGcgtGgsllllaealkllgpdgkvvgiDispemlevarglldnvtli---
00451091   1/1  gnvtfihgDalelpfpdgkfDlivsNpPynistavlehl..........pdleelrrlvlmlqleealrl
00446891   1/1  gnvefivgDaeelpfpdesfDlivsnaplhhl........................leellrlLkpgGrl
00516171   1/1  engladnvefiqgDaedlplpdfDlvvsnlpl................hhlpd..leavlaelarv----
00413261   1/1  gnvefivgdaeelp.gkfDlivsNPPyvplsdilllevldleplsallehlddleelleeaarlLkpgGr
00501541   1/1  lglnvefvvgDaedlpfpdgsfDlvvsnavlhhlpded.............leallrel...arvLkPGG
00476561   1/1  kerakelglsdnvnvefivgdaeellleqlepfedekfDliisnnvl................hhvpd..
00350261   1/1  kareglyplgllrglplellkryflkllgadgglyrvkpelrdrveflqgdlldlpppldgsfDlifcrn
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  lkelgdnvefiqgdaldlpellllfpdgsfDlilsDpPysslgllifvlhhled................
00525361   1/1  lseemlevarerlaeaglprvefvvgdaedlpfpdgsfDlivssevlhhl.sdedl..............
00507491   1/1  elnglnveviqgdalelp.gkfDlvvsNPPyiitsk.illklllklepelaldvledlldleelleaaar
00486291   1/1  kVtgvDisp.mlelarenaklngldnrvefiqgdaedlplpdekfDlvvsnpvl...............h
00445501   1/1  cpildeillellprlrellsrldeltkegllrllllrsgelllllvdkpldedveealkalyd...lfdd
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  lgllnrvefvqgdalalplpdgsfDgvlldlglsslgldradndeled........laealeeaarv---
00390931   1/1  lkp..pkrvLdiGgGtGglarellkhgpvakvtgvdidpevielarenfklnglalddprvevivgDale
00379821   1/1  GkvvgvDispemlelarenleklgnvefilgDaeelpkyllpdgsfDvilsdaplsh.............
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  aklngldednvefiqgdaldflplllldekfDlivsnppy.................glegledlekllk
00526181   1/1  fklgefytprpvtellvelllpklgdlkglrvLDpgCGsGgllialakrlpnaggaevtllGvDispeal
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  yllggvefadlplyktgvfitqdeasallaelldlkpgdrVLDlgaGsGgltlalaelvgpggrvvavDi
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  slplfkdglvltqdavsellvelldpkpgdrVLDlGcGsGglalalaklvgpagrvvavDispealelar
00366101   1/1  ealelakenaklngldnrkvefiqgdaed.plpdgkfDlivsnppyllgle.................dl
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  gvvqsterdefiyhemlahlllllhpnpk...rvLdiGgGtGglarellkhlpvekvtavEidpeviela
00488051   1/1  GkVygvDispemlelarenleelgnvefilgDaeellklpfpdgsfDvvlsdavlhpdp...........
00529821   1/1  ldiGcGtGtlailllrlgparrvvavDispevvelakkrlqalglenrvtfilgdaldilrdllell---
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  gnvefiqgDalklpfpdgkfDlivsNpPynissavl..........hhledlekarrltlmlqleealrl
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  tgiDidpdalevarknlkrlglpkrvrlvvgdaldalpalaegvedgkfDliild.fvlehlad...---
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  glsvlnagalddprvevivgDalellfedekfDviiaDlpdsiglphlldle..................
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  Dlsp.mlelar.....vefiqgdardlplldlllellpdgsfDlvlsdapl.shlgdlrr......dlar
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  nplniefivgdalqlplpggfDlilsnfvlehled.....................prkllrelarvLkp
00530871   1/1  eivvgDalellpdesfDliiaNPPyggsgdldrlldellkrlydelalalsgvlglldlyrafleea---
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  lgldlhleklgyaldnvefilgdaeellkllpdgsfDavfl.dl.pd.....................pe
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  lkerlkgpnvevingDaldldelllllpddfvsnlvlhhlpdp...........................
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  DlgcGtGgltlalaklvgaagvvavDispealelarenaelnglnvefivgDalellkllpdgkfDlill
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           PFLGKSPEGVEEGLRRLGFDRVERVGEGEYFLVLARKPEALAAVRLEEREAPPPEEAEEVAVALEEARAL
00450601   1/1  snfgvlhhlPpyfldpedle...............aalr-------------------------------
00509191   1/1  aflaeaarlLkPGGvlvistllgwdeeledllevvrlv--------------------------------
00421971   1/1  vgdaedlpfpdgsfDlvvssfvlhhl--------------------------------------------
00468401   1/1  lpsfDlvvsngvlh.hlpdpel...............e--------------------------------
00490741   1/1  vvgDaed.plpdsfDlvvsngvlhhl.pdpdlea.......-----------------------------
00507621   1/1  LkPGGrlvlstpnpegleellalllallllelvllvdl--------------------------------
00468381   1/1  aed.plpsfDlvvsngvlhhlpdpe.............--------------------------------
00516571   1/1  pdpeaflreaarvLkPGGvlvls-----------------------------------------------
00495321   1/1  lpgarvtgvDispealelarenaalngldnvefvqgD---------------------------------
00496711   1/1  vvsnavlhhlpvedpe................allre---------------------------------
00473861   1/1  kpGGrlvlsepnlpdleellelllelllellpllglll--------------------------------
00463541   1/1  ............lleellrlLkpGGrlvlstilleg..l-------------------------------
00518421   1/1  Grlvlstpnreslpelrelllaylllkllfpelgyrlld-------------------------------
00478511   1/1  ngvlehllleggldglpdpe......--------------------------------------------
00430851   1/1  rlgldlllpdnvefivgdaedlpfpdgsfDlvvs------------------------------------
00498851   1/1  fDlvvsnppl................ehlpd.....l---------------------------------
00507451   1/1  vtgvDispealelarenaklngldnvefiq----------------------------------------
00467441   1/1  lphvpdp.................e---------------------------------------------
00530771   1/1  lllstpnrldlrkglppplrllsleellelleeaGfevv-------------------------------
00415801   1/1  efivgdaleflpfpdgkfDlivsNPPygglsellievl--------------------------------
00476761   1/1  y......................dlealleelarlLkpgGr-----------------------------
00509351   1/1  daedlpfellldgsfDlivs.....r--------------------------------------------
00499151   1/1  lddpnvefivgDaedflpfldgsfDlivsdpplhhlpdpel..........-------------------
00401961   1/1  ........alkelarvLkpGGrlvlstinledleelr---------------------------------
00403271   1/1  ...............hhlpdeelvkllkeayraLkpg---------------------------------
00466961   1/1  relarvLkPGGrlvlstpsppllpeelelllke-------------------------------------
00474711   1/1  vefivgDaedflpfldgsfDlivsdpplhhlpdpe..---------------------------------
00414441   1/1  Grlvlseptlegeepeelldfilryifpggflsleell--------------------------------
00514491   1/1  arvLkpGGrlvlstpnldyleellellkal----------------------------------------
00511031   1/1  ivgDaedlpfpdgsfDlvvsngvlhhlpdpelk..........---------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  arvtgvDispealelArenakrlglddnv-----------------------------------------
00491221   1/1  fDlvvsnfavlhhlptgrrdpedlea............--------------------------------
00473291   1/1  vvgDaedlplpdgsfDavvs...dlpdp....--------------------------------------
00509881   1/1  pnvefivgDaedllkplpdgsfDliisdpplhhl...---------------------------------
00475801   1/1  rlvlvvgtleg..leellellkeagfevvev---------------------------------------
00527091   1/1  arvLkpgGrlvlsdpnrpdlleleelllllpretlrlg--------------------------------
00497191   1/1  efivgDaedplpdg.fDlivssgvlhhlpdpe--------------------------------------
00479191   1/1  ea................llrelarvLkPGGrlvlst---------------------------------
00526491   1/1  lekllkelarvLkpGGrlvlstpnrdy-------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  rvLkPGGrlvlstpnlpdlellrlllalllrlld------------------------------------
00528071   1/1  LkPGGrlvlstp.....sppgleellellr----------------------------------------
00511431   1/1  GGrlvlstpnrpdleelrelldllerlllpg---------------------------------------
00512391   1/1  kpgGvlvistlnpedlpellaileleellglvprilkyi-------------------------------
00518231   1/1  aelllelld..pgkrvLDlGcGtGglala-----------------------------------------
00516791   1/1  hvceglddlra............alaelarvLkPGGrlv-------------------------------
00469311   1/1  ...........leallrelarvLkPGGrlvl---------------------------------------
00472111   1/1  Davvssfvlhhvpp..............dlpdleralr--------------------------------
00479451   1/1  pfpdgkfDlvvsDppfsgvlhhvpd---------------------------------------------
00484381   1/1  .....eallreaarlLk-----------------------------------------------------
00502421   1/1  Grlvlsepnrpsleelllllllllllllphgrflsleel-------------------------------
00491711   1/1  PGGrlvlstpnpddllellellrflerlylllfgllep--------------------------------
00518851   1/1  gvDispealelarenlaenglalddpnvefivgDaedflpfpdgsfDlivsdpplhh-------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ispealelarenaklngleddnvefiqgDae---------------------------------------
00512611   1/1  ....elleelarlLkpGGrlvlstpti..eqleellelleeaGf--------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  LkpgGrlvlvvgtledveillkvp----------------------------------------------
00446891   1/1  vlvdgnpeg...elldkllkllllllkeelfevdfv----------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  lvlstplptq..leellellekagfkvvvvlev-------------------------------------
00501541   1/1  rlvlstpnrpdllsleeleelleragftg-----------------------------------------
00476561   1/1  leaalkelyrlLkpgGklliiep-----------------------------------------------
00350261   1/1  vliyfdd..............-------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ..leefleealrvLkpgGrlvlv-----------------------------------------------
00525361   1/1  .aaflrelrrvLkPgGllvisdpvlpddlrlddlpggr--------------------------------
00507491   1/1  lLkpgGrlvlvipsrflp........lekvlelvvklak-------------------------------
00486291   1/1  hlpnesdlekllkelkrlLkpgGrlilsditly-------------------------------------
00445501   1/1  iyrlylgepleylagef-----------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  flkeldekfDviilDlpdpilgpleh...................lyteef-------------------
00379821   1/1  ......lpde.aleealrvLkpGGrl--------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  earlLkpgGilvleinpetlee...llel-----------------------------------------
00526181   1/1  e---------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  -----------------------------------------------sieaavssdpqlaeilkelGnal
00519441   1/1  spealelarenaerlgldnveviqgDaldlplldllg---------------------------------
00521001   1/2  --------------------------------------------------------PenaealkelGnal
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  enakrlgldnveviqgDaldlpledgkfDlilsdpPy---------------------------------
00366101   1/1  eklleeaarlLkpgGilllstnprt..laeellelle---------------------------------
00464951   1/2  -------------------------------------------------------dpdkaeslyklgval
00512401   1/3  ------------------------------------------------------ldpdnalallllglll
00532291   1/1  rkyfpllglalddprvevvvgDaleflkeldekfDvIil-------------------------------
00488051   1/1  .........eaaleealrvLkpGGr---------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ---------------------------------------------iellekaleldpdnaealkllGnal
00426821   1/1  LkpgGrlvilvqnltlvelllkvpkea-------------------------------------------
00526461   1/3  -----------------------------------------------------paeellekaleldpdda
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  eflrelyrvLkpgGvlvvnslspd----------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  laalqlalleealrlLkpgGrlvlstcs..eeneevlla-------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  gGrlvlvtpnlespepsnvlddlll---------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  -------------------------------------------------------ePkdalaylllglll
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ealeellrvLkpGGrlvi----------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ...ek-----------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  DPPysgsgtlrr...vpdieprlalkglldllelqr----------------------------------
00456921   1/3  ------------------------------------------------------------------alay
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  -----------------------------------------------------yeeAielyekAlkllkk
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  -----------------------------------------Alaalekaleldpdnae...allnlGlal
00487321   1/2  -------------------------------------------------------npvdadtyfnyawaL
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ---------------------------------------------------------------yllGlal
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ------------------------------------------------------------------egel
00526701   1/4  -------------------------------------------------vsaleldpdrfeallalgral
00486481   1/3  -------------------------------------------------------------dpealfnlG
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LEAGRYAEALALLPEEAEGEAAYLRGRALFALSRHAEAEEALRRALSEEAEDLRALALVELGEYERARGR
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ---------------------------------------------------yllGlallklgdyeeAiel
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  fkeGnyeeAillfqkalkilknyleidpedlklllelqptlllnlalahlklgeydeAvelfrkalelqP
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  fklgdyeeAielytkaleldpdnaeaylnlalaylklgdyeeAledyekaleldpdnakayynlglallk
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  yelgdyeeAielfseaikikpkvlfllavayyklgkyeeAvkdldealkidpslakaylnlGnallklgk
00512401   1/3  lelgelekaleayekallepndaealfnlawallkssnlgdyeeAielleealkldpenlrealyylala
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  fklgdyeeAielyekalellpellealleealeldpdnaeaylnlalaylklgdyeeAiedyekaleldp
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  eallnlGnalfklgdyeeAielyekalelllkllgleellllddpdnleaeallnlglaylklgdyeeAl
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  -------------------eallalgrallalgryeeAiaaleralalwpgdalgdldealwllaealrl
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  lklgdyeeAlelfekaleldpenaealfnlalallklgdyedveeAiellekallkeldpdnpealyyla
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  lklgdyeeAledyekaleldpnnakayynlglallklgdyeeAledyekaleldpnnaeallnlglallk
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  sslflsllflsskpdyeeaaeaylkaGnaykllgeyeeAleayekalelyeklgsdpdaaealynlglly
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  lklgrleeAlaafekaleldPdnaeawlnlGlallelgrleeAlaalekaleldpdnaealynlglalla
00487321   1/2  vkssnledveeaielLeellrlnspslrrellYylAvayyklgdYekAlkyldllLelePdnlqalnlkk
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  -----lekalrlepdyst..alenlgvlliqigeleeAlqayqraleldpndpkaylnlGlvlaklkeld
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  -----------------PigdfielspdpvtvsletlekylllaelllnlGnelyelgkyeeAlecykrA
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  lklgdyeeAielyekaleldpdnaeallnlglallklgdyeealeal-----------------------
00496441   1/2  --------------nPdnaelllnlglalyklgdydkAlklfekalslspdraealynlpdlleslglly
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  lglalqelgeyeeaiadydkaleikelldpdyaeayynrGvallslglydeAiadydkAlelnPdyaeay
00526701   1/4  lalgryeeAiaal---------------------------------------------------------
00486481   1/3  layyklgdyeeAielyekaaelgpadaqaylglgyllgygvlgdyekAleyykkaaelgpanaqanlgll
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LEALAVRGGRYRLALGRVYLAQGRYADALRQFVESGLPEADLYTRETLERITERMRRFAREGEWAEVSRR
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  yekaleldpdnaeallnlglallklgdyeealeal...................................
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ndakaflrlglvllnlgdyeeAleyfkkaleldpsdieavsllgklllrlg-------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  lgryeeAleayekaleldpdnaealylnlgla--------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  yeeAikayekalkldpdnalalyqleaieikpdla-----------------------------------
00512401   1/3  yyklgdyekAlkylekaleldpdnlqalnllal-------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  dnakalyrlglaylklgdyeeAledfekalel--------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  edyekaleldpdnakalynlglallklgdy----------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  epdrleallnlaeallalgrydeAlaaleral--------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  laly------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  lgkye..yekaleldpnnaeaylnlgl-------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  kklgdyeeAieayekalelypkngdfsqaakall------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  lgdy------------------------------------------------------------------
00487321   1/2  liedkiakdgliGiaivggaalvvagllga----------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  eAlkvyreaLelnpanaealanLgnlllklgr--------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  lsllpnylealllekaieldpdlaevllnlalay------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  yllgkyeeAiallekaleldPnht----------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  nnlGlallqlgeydeAieaydkaleldPdyae--------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ylnglgvlkdyekAlkyyekaaepgnaeayyn--------------------------------------
00392762   2/4  -----------ePkdalaylllgllllklgdy--------------------------------------
00526703   3/4  -------------------------------------vsaleldpdrfeallalgrallalgryeeAiaa
00472562   2/4  ---------ealynlglallalgdyeeAleal--------------------------------------


                         -         -         +         -         -         -         -:490
query           AEFVEDLSPGLLTREMLRLGLRAALIQGLFARAERYARRLADLDEAEGFLGLALAALRVKSPLELRGGED
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  -----------------------dpealfnlGlayyklgdyeeAielyekaaelgpadaqaylglgyllg
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ..............................glleeAieayekaleldpdnaealynlglallklgkllgl
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ---------------------ngygvkgdyeeAlelyekaaelgpaeayynlglly...........lgd
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  -----------------------------yeeAielyekAlkllkksslflsllflsskpdyeeaaeayl
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  --------------------------------------------------------------------eP
00512402   2/3  -------------------------------------------------ldpdnalallllgllllelge
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  leralalwpgda....................lgdldealwllaealrlepdrleallnlaeallalgry
00472562   2/4  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           LKAVEPYLTEALSRAEIPEALLLLGVLREREGRFREALHLLERAAFRGEGEVAGMAYHHLAQVKRALRRP
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ygvlgdyekAleyykkaaelgpanaqanlgllylng.....lgvlkdyekAlkyyekaa.epgnaeayyn
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  --------------PenaealkelGnalfklgdyeeAielytkaleldpdn..aeaylnlalaylklgd.
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  -----PigdfielspdpvtvsletlekylllaelllnlGnelyelgkyeeAlecykrAlsllpnyleall
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  allalgdyeeAieayekaleldpnnaealynlgllllklgrye---------------------------
00464952   2/2  -------------dpdkaeslyklgvalyelgdyeeAielfseaikikpk.....vlfll..........
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  yekAleyyekaae.pgnaeayynlGllylkGlgvlkdyekAleyyekaaelgp....aeayynlGllylk
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  -------------------llynlgrtlieekdllealvsfeealelnPksveal...............
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ------------sieaavssdpqlaeilkelGnalfkeGnyeeAillfqkalkilknyleidpedlklll
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ---------------paeellekaleldpddaeallnlGnalfklgdyeeAielyekalelllkllglee
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  -----------------iellekaleldpdnaealkllGnalfklgdyeeAielyekalellpelleall
00429322   2/3  kaGnaykllgeyeeAleayekalelyeklgsdpdaaealynlgllykklgdyeeAieayekalelypkng
00472563   3/4  --AlaalekaleldpdnaeallnlGlallklgrleeAlaafekaleldPdna..eawlnlGlallelgr.
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  --------kaleldpenaealknlGnalfklgdyeeAielytkaleldpnn..aeaylnlalaylklg.d
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  kdalaylllgllllklgdyeeAlelfekaleldpenaealfnlalallklgdyedveeAiellekallk-
00512402   2/3  lekaleayekallepndaealfnlawallkssnlgdyeeAielleeal.kldpenlrealyyl-------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  deAlaaleralaldPlreralallglalyrlGrraeAlaayeralellpdelgvepgpelralyeailrg
00472562   2/4  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           LKEVLGDHKRAHALRAYPAPYLFRLAQEALEGGEEVLARELLSRARDAGLEAVAEEDLTGLIHLLERLEG
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  lGllylkGlgvlkdyekAleyykkaaelgpanaqaylglllgng.ygvlgdyeeAleyyekalelgpada
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  yeeAledyekaleldpdnakayynlglallklgryeeAleayekalel..dpdnaealylnlglallklg
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ......................................................................
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  .............................................................avayyklgk
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  GlgvlkdlekAlkyykkaaelgp-----------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ..........................................................ynlgevlkelkl
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  --------------------------------------------vsaleldpdrfeallalgrallalgr
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  elqptlllnlalahlklgeyd.eAvelfrkalelqPndakaflrlgl-----------------------
00516423   3/3  ----------------------yllGlallklgdyeeAielyekaleldpdn..aeallnlglallklgd
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  llllddpdnleaeallnlglaylklgdy.eeAledyekaleldpd-------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  eealeldpdn..aeaylnlalaylklgdy.eeAiedyekaleldpdn-----------------------
00429322   2/3  dfsqaakallnlaelyeellgdyeeAleyyekalelyesegddplaaeallnladlyaklgdyeeAiely
00472563   3/4  leeAlaalekaleldpdnaealynlglallalgdyeeAlealekale-----------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  yeeAledyekaleldpnnakayynlglallklgdyeeAledyeka-------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  --------------------------------------------------------------ngygvkgd
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  dpllaappaptpaaalvpllppvlll--------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           PWAAFSVLYQALSRTPQPPLELLALAYRLSRAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAH
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  qaylglllgngygvlgdyeeAieyyekalelg--------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ryeeAleayekaleldpdnalay..................................eealellekalel
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ......................................................................
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ---AlaalekaleldpdnaeallnlGlallklgrleeAlaafekaleldPdnaeawlnlGlallelgrle
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  yeeAvkdldealkidpsl....akaylnlGnallklgkyeeAikayekalkldpdnalalyqle.aieik
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  -----------------------------------ePkdalaylllgllllklgdyeeAlelfekaleld
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  yrdalelyeealeLsPenpevyvnvavvlleldrleeAillyeealelkPddvkaylnlglallllgqld
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  yeeAiaaleralalwpgdalgdldealwllaealrlepdrleallnlaeallalgrydeAlaaleralal
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  yeealealglleeAieayekaleldpdnaealynlglallklgkl..........lglallalgdyeeAi
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------iellekaleldpdnaealkllGnalfklgdyeeAielyekal
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ------------------------------kaleldpenaealknlGnalfklgdyeeAielytkaleld
00526463   3/3  ------------------------paeellekaleldpddaeallnlGnalfklgdyeeAielyekalel
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  pndpeaylnlglallelgrleaaeallkalellpelapayalaglnlgnlselglldeAiadyekaieln
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ekalelapdnsllkygl-----------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  --------------------yeeAielyekAlkllkksslflsllflsskpdyeeaaeaylkaGnaykll
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  -----------------ldpdnalallllgllllelgelekaleayekallepndaealfnlawallkss
00486483   3/3  ---------------------------------------------dpealfnlGlayyklgdyeeAiely
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  yeeAlelyekaaelgpaeayynlglly........lgdyekAleyyeka...................ae
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ---------------------------------------------------------------------n
00487322   2/2  ------------------------------------------yeslleellsleelkvlkkqyekeleln
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ---------------------------sieaavssdpqlaeilkelGnalfkeGnyeeAillfqkalkil
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           PQALEVLFDLAEHHEAQGDWRRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKA
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  dpdnaeayynlglallklgdyeeAlealekale-------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ......lekaieldpdlaevllnlalayyalgrydeAieclkkaleldpdnvkalynlalalyslgdyee
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  eAlaalekaleldpdnaealynlglallalgd--------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  pdlalalnnlGllylrlgdydeAieaykkaikldprlavayvnlglaylelgdyde--------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  penaealfnlalallklgdyedveeAiellekallkeldpdnpealyylalalyklgdyeeAlkyfekal
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  eAvllydkalklePgfleavlllssllaqlglldeallalesalrvdPddvdallnlatvlralgrleeA
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  dPlreralallglalyrlGrraeAlaayeralellpdelgvepgpelralyeailrg-------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  eayekaleldpnnaealynlgllllklgr-----------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ellpellealleealeldpdnaeaylnlalaylklgdyeeAiedyekaleldpdnakalyrlglaylkl-
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  pnnaeaylnlalaylklgdyeeAledyekaleldpnnakayynlglallklgdyeeAledyekal-----
00526463   3/3  llkllgleellllddpdnleaeallnlglaylklgdyeeAledyekaleldpdnakalynlglallklgd
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  pdlaeayfnlGlallklgdydeAiadykkAlelnpdnavaynnaglalskl-------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  geyeeAleayekalelyeklgsdpdaaealynlgllykklgdyeeAieayekalelypkngdfsqaakal
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  nlgdyeeAielleealkldpenlrealyylalayyklgdyekAlkylekale....ldpdnlqalnll--
00486483   3/3  ekaaelgpadaqaylglgyllgygvlgdyekAleyykkaaelgpanaqanlgllylnglgvlkd------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  pgnaeayynlGllylkGlgvlkdyekAleyyekaaelgpaeayynlGllylkGlgvlkdlekA-------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  PdnaelllnlglalyklgdydkAlklfekalslspdraealynlpdlleslgllyyllgkyeeAiall--
00487322   2/2  pvdadtyfnyawaLvkssnledveeaielLeellrlnspslrrellYylAvayyklgdYekAlkyldl--
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  knyleidpedlklllelqptlllnlalahlklgeydeAvelfrkalelqPndakaflrlglvllnlgdye
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           VGEGLKALGEEAPHLPEAPRDLLEEDLPRFHGEHLVVVGGHTQLRSRLVPFLEGRGLRVDWYDADTVGVG
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  Aieylrka--------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  etllekal--------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  yeeAleale-------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  lnlael----------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  eAleyfkkaleldpsdi-----------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           KEALRRILNRLEKAHGLMIVSSYVGHDLSEPVRLEAERLGVPVHVIPGRARGTTGFLRALKQFAPEVLKR
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           ALKGVE----------------------------------------------------------------
00450601   1/1  ----------------------------------------------------------------------
00509191   1/1  ----------------------------------------------------------------------
00421971   1/1  ----------------------------------------------------------------------
00468401   1/1  ----------------------------------------------------------------------
00490741   1/1  ----------------------------------------------------------------------
00507621   1/1  ----------------------------------------------------------------------
00468381   1/1  ----------------------------------------------------------------------
00516571   1/1  ----------------------------------------------------------------------
00495321   1/1  ----------------------------------------------------------------------
00496711   1/1  ----------------------------------------------------------------------
00473861   1/1  ----------------------------------------------------------------------
00463541   1/1  ----------------------------------------------------------------------
00518421   1/1  ----------------------------------------------------------------------
00478511   1/1  ----------------------------------------------------------------------
00430851   1/1  ----------------------------------------------------------------------
00498851   1/1  ----------------------------------------------------------------------
00507451   1/1  ----------------------------------------------------------------------
00467441   1/1  ----------------------------------------------------------------------
00530771   1/1  ----------------------------------------------------------------------
00415801   1/1  ----------------------------------------------------------------------
00476761   1/1  ----------------------------------------------------------------------
00509351   1/1  ----------------------------------------------------------------------
00499151   1/1  ----------------------------------------------------------------------
00401961   1/1  ----------------------------------------------------------------------
00403271   1/1  ----------------------------------------------------------------------
00466961   1/1  ----------------------------------------------------------------------
00474711   1/1  ----------------------------------------------------------------------
00414441   1/1  ----------------------------------------------------------------------
00514491   1/1  ----------------------------------------------------------------------
00511031   1/1  ----------------------------------------------------------------------
00494741   1/1  ----------------------------------------------------------------------
00484901   1/1  ----------------------------------------------------------------------
00491221   1/1  ----------------------------------------------------------------------
00473291   1/1  ----------------------------------------------------------------------
00509881   1/1  ----------------------------------------------------------------------
00475801   1/1  ----------------------------------------------------------------------
00527091   1/1  ----------------------------------------------------------------------
00497191   1/1  ----------------------------------------------------------------------
00479191   1/1  ----------------------------------------------------------------------
00526491   1/1  ----------------------------------------------------------------------
00479231   1/1  ----------------------------------------------------------------------
00502341   1/1  ----------------------------------------------------------------------
00528071   1/1  ----------------------------------------------------------------------
00511431   1/1  ----------------------------------------------------------------------
00512391   1/1  ----------------------------------------------------------------------
00518231   1/1  ----------------------------------------------------------------------
00516791   1/1  ----------------------------------------------------------------------
00469311   1/1  ----------------------------------------------------------------------
00472111   1/1  ----------------------------------------------------------------------
00479451   1/1  ----------------------------------------------------------------------
00484381   1/1  ----------------------------------------------------------------------
00502421   1/1  ----------------------------------------------------------------------
00491711   1/1  ----------------------------------------------------------------------
00518851   1/1  ----------------------------------------------------------------------
00521821   1/1  ----------------------------------------------------------------------
00519301   1/1  ----------------------------------------------------------------------
00512611   1/1  ----------------------------------------------------------------------
00520011   1/1  ----------------------------------------------------------------------
00451091   1/1  ----------------------------------------------------------------------
00446891   1/1  ----------------------------------------------------------------------
00516171   1/1  ----------------------------------------------------------------------
00413261   1/1  ----------------------------------------------------------------------
00501541   1/1  ----------------------------------------------------------------------
00476561   1/1  ----------------------------------------------------------------------
00350261   1/1  ----------------------------------------------------------------------
00486482   2/3  ----------------------------------------------------------------------
00408291   1/1  ----------------------------------------------------------------------
00525361   1/1  ----------------------------------------------------------------------
00507491   1/1  ----------------------------------------------------------------------
00486291   1/1  ----------------------------------------------------------------------
00445501   1/1  ----------------------------------------------------------------------
00521002   2/2  ----------------------------------------------------------------------
00505191   1/1  ----------------------------------------------------------------------
00390931   1/1  ----------------------------------------------------------------------
00379821   1/1  ----------------------------------------------------------------------
00473662   2/2  ----------------------------------------------------------------------
00531071   1/1  ----------------------------------------------------------------------
00526181   1/1  ----------------------------------------------------------------------
00472564   4/4  ----------------------------------------------------------------------
00516422   2/3  ----------------------------------------------------------------------
00464952   2/2  ----------------------------------------------------------------------
00486991   1/3  ----------------------------------------------------------------------
00519441   1/1  ----------------------------------------------------------------------
00521001   1/2  ----------------------------------------------------------------------
00392764   4/4  ----------------------------------------------------------------------
00478321   1/2  ----------------------------------------------------------------------
00474651   1/1  ----------------------------------------------------------------------
00366101   1/1  ----------------------------------------------------------------------
00464951   1/2  ----------------------------------------------------------------------
00512401   1/3  ----------------------------------------------------------------------
00532291   1/1  ----------------------------------------------------------------------
00488051   1/1  ----------------------------------------------------------------------
00529821   1/1  ----------------------------------------------------------------------
00402511   1/3  ----------------------------------------------------------------------
00426821   1/1  ----------------------------------------------------------------------
00526461   1/3  ----------------------------------------------------------------------
00518401   1/1  ----------------------------------------------------------------------
00503582   2/2  ----------------------------------------------------------------------
00409641   1/1  ----------------------------------------------------------------------
00526702   2/4  ----------------------------------------------------------------------
00465681   1/1  ----------------------------------------------------------------------
00526704   4/4  ----------------------------------------------------------------------
00528941   1/1  ----------------------------------------------------------------------
00530871   1/1  ----------------------------------------------------------------------
00486992   2/3  ----------------------------------------------------------------------
00516423   3/3  ----------------------------------------------------------------------
00392761   1/4  ----------------------------------------------------------------------
00402513   3/3  ----------------------------------------------------------------------
00518841   1/1  ----------------------------------------------------------------------
00456923   3/3  ----------------------------------------------------------------------
00526463   3/3  ----------------------------------------------------------------------
00473031   1/1  ----------------------------------------------------------------------
00526462   2/3  ----------------------------------------------------------------------
00494421   1/1  ----------------------------------------------------------------------
00456921   1/3  ----------------------------------------------------------------------
00510372   2/2  ----------------------------------------------------------------------
00402512   2/3  ----------------------------------------------------------------------
00429322   2/3  ----------------------------------------------------------------------
00472563   3/4  ----------------------------------------------------------------------
00429323   3/3  ----------------------------------------------------------------------
00429321   1/3  ----------------------------------------------------------------------
00512403   3/3  ----------------------------------------------------------------------
00486483   3/3  ----------------------------------------------------------------------
00472561   1/4  ----------------------------------------------------------------------
00487321   1/2  ----------------------------------------------------------------------
00456922   2/3  ----------------------------------------------------------------------
00503581   1/2  ----------------------------------------------------------------------
00478322   2/2  ----------------------------------------------------------------------
00473661   1/2  ----------------------------------------------------------------------
00496442   2/2  ----------------------------------------------------------------------
00487322   2/2  ----------------------------------------------------------------------
00516421   1/3  ----------------------------------------------------------------------
00496441   1/2  ----------------------------------------------------------------------
00486993   3/3  ----------------------------------------------------------------------
00392763   3/4  ----------------------------------------------------------------------
00512402   2/3  ----------------------------------------------------------------------
00510371   1/2  ----------------------------------------------------------------------
00526701   1/4  ----------------------------------------------------------------------
00486481   1/3  ----------------------------------------------------------------------
00392762   2/4  ----------------------------------------------------------------------
00526703   3/4  ----------------------------------------------------------------------
00472562   2/4  ----------------------------------------------------------------------