[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81585.1


[Show Plain Result]

## Summary of Sequence Search
   1::198
   1::200  1.7e-54 48.0% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
   1::193  1.2e-45 38.6% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
   2::200  1.1e-33 35.4% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   4::191  2.3e-33 37.1% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
   2::199  4.1e-33 32.8% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   2::197  5.1e-30 33.0% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   1::185  3.9e-29 35.7% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
   3::194  1.2e-28 36.1% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   1::197  2.1e-27 34.1% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   3::194  3.1e-27 31.3% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
   1::200  5.2e-27 31.2% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
   1::183  1.3e-26 32.2% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   2::198    5e-26 35.4% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   4::193  7.2e-25 37.6% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
   1::198    9e-25 37.8% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   4::195  1.2e-24 30.7% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
   1::195  2.2e-24 32.1% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
   1::198  3.3e-23 34.1% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
   4::194  3.6e-23 34.9% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
   3::194  4.2e-23 36.4% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
   2::194  4.5e-23 36.8% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
   4::193  6.3e-23 33.9% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
   1::194  8.7e-23 35.1% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
   1::194  9.3e-23 36.0% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   2::196  2.1e-22 32.0% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
   1::199  3.9e-22 34.9% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   1::197    8e-22 34.0% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
   1::194  1.8e-21 35.2% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
   1::177  2.8e-21 32.4% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   1::196    5e-21 33.9% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
   1::199    1e-20 29.7% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   4::194  1.2e-20 35.9% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
   2::199  2.2e-20 36.0% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
   1::198  4.8e-20 32.9% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
   1::195  5.6e-20 30.7% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
   1::193  1.8e-19 34.2% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
   2::197  1.9e-18 34.4% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
   3::194  2.1e-18 31.8% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
   1::194  2.8e-18 30.5% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
   2::199  3.8e-18 30.3% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   1::199  7.1e-17 33.8% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
   1::198    9e-17 27.9% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
   1::196  3.5e-15 27.6% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   1::196  1.5e-14 25.3% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
   4::200  3.7e-14 27.0% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
   1::168  6.9e-14 29.7% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
   2::140  3.3e-13 26.0% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
   1::180  4.1e-12 32.2% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
   1::196  1.1e-11 30.2% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
   2::190  2.1e-11 24.4% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   1::197  1.3e-08 25.8% 0042605 00426051 1/1   p containing nucleoside triphosphate hy 
   3::159  1.4e-07 24.4% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
   2::36   3.7e-06 40.0% 0048410 00484101 1/1   p containing nucleoside triphosphate hy 
   8::200    1e-05 26.0% 0051325 00513251 1/1   p containing nucleoside triphosphate hy 
   2::36   1.4e-05 48.6% 0048025 00480251 1/1   p containing nucleoside triphosphate hy 
   2::36   3.4e-05 46.9% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
   2::36   3.9e-05 48.6% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
   3::194    6e-05 21.3% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
   2::36   8.6e-05 45.7% 0046860 00468601 1/1   p containing nucleoside triphosphate hy 
   1::36   8.8e-05 44.4% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
   2::36   0.00011 45.7% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
   1::36   0.00015 44.4% 0046913 00469131 1/1   p containing nucleoside triphosphate hy 
   1::42   0.00022 40.0% 0050989 00509891 1/1   p containing nucleoside triphosphate hy 
   3::36   0.00024 41.2% 0048545 00485451 1/1   p containing nucleoside triphosphate hy 
   2::36   0.00028 45.7% 0047537 00475371 1/1   p containing nucleoside triphosphate hy 
   1::36    0.0004 44.4% 0037384 00373841 1/1   p containing nucleoside triphosphate hy 
   1::36    0.0006 44.4% 0047406 00474061 1/1   p containing nucleoside triphosphate hy 
   1::27   0.00085 48.0% 0046315 00463151 1/1   p containing nucleoside triphosphate hy 
   4::36   0.00095 40.6% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
   1::198


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
00464421   1/1  MkkgkfIvieGpdGsGKTTlaklLae.l.elgigvvvtrEPvdywrevggtpllelirelllaldfgeil
00487061   1/1  ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllrlirelllrlgfge
00533501   1/1  -rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtplgrgigyvfqdpalfpgltvrenle
00469161   1/1  ---llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdlilvpdllvl
00532471   1/1  -pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivdegrliglvfqdldl
00464411   1/1  -vkkgeiivllGpsGsGKsTlaklLagllgptggsvlltgepvsgeplgeligevfqdgilfpdltvlen
00420081   1/1  smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvggsdlleliyqlplrldlgei
00478131   1/1  --kgkvivltGppGsGKtTlarlLaellkplglgvvvidgddlrreavgqlglglsieeldealllpdal
00533151   1/1  MsldikkgklivltGppGsGKtTlarlLaerl...glpfistddllrelv..pggldigevfqda.leag
00478081   1/1  --gkvivltGppGsGKtTlarlLaellkplgggvvvidtddlrreairelllgldlleilfeglllsdef
00487021   1/1  rm..kiivltGpsGsGKsTlarlLaell...gvvvidtddllragevfqdyalfphltvlelldnvllgl
00475381   1/1  mkgeiialtGpsGsGKsTlarlLagllkptsgivsvdglrlavlsrdllgllreglirigyvfqdyalfp
00496571   1/1  -GkgelivllGpsGsGKsTlarlLagll...ggsvldtgepirgeplgelirglvfqdpllldeltvlen
00486921   1/1  ---mlivltGppGsGKtTlakaLaerlglpfistddllreavpggtd........lgelfqelllegell
00515351   1/1  mngklivltGppGsGKtTlaraLaerl...glpvistddllreavpg.gtdigelfqdyllfpfltvden
00518511   1/1  ---klIvleGpsGsGKsTlaklLaekl...glpfidtddl.......................liaadlg
00478391   1/1  msikkgklilltGppGsGKtTlaralaerl...glpvidgddllrelvgeggrlgrd......lfdedrl
00512061   1/1  kkkkgklivltGppGsGKtTlakaLaerlg..glvvidtddllrea..........gkirelfgflgelv
00493061   1/1  ---mlIvltGppGsGKtTlakaLaerlglpvistddllreavpggtelgey..irdlfdeggl.......
00496061   1/1  --gklivltGppGsGKtTlaklLaerl...glpvistddllreevepggtdlgeifqalllagellfdde
00457851   1/1  -PkgklivltGppGsGKtTlakaLaerl...glpvistddllreavpggtrlgeviqdlfllgg...llf
00486891   1/1  ---mlivltGppGsGKtTlakaLaerl...glpvidtddllreleidgtplgeeirdl.llagellfrae
00464591   1/1  k...livltGppGsGKtTlakaLaerl...glpfistddllreavlggtplgeeirdl.leagallpdal
00499331   1/1  PslslkkgklivltGppGsGKtTlakaLaerl...glpfidtddllrepvig.agtdigevfqdlllagg
00457881   1/1  -mgklivltGppGsGKtTlaklLaerl...glpvidtddllrelepdg.....telgellqdlllaggll
00472911   1/1  mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggkpl.............gllfe
00482721   1/1  k.gkiigltGpsGsGKsTlarlLae.l...glpvidtddlyrelvaggtplgerirellgegyllpdeal
00516041   1/1  mlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl..........lrgeelgriielfdear
00434401   1/1  MlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaell.
00489391   1/1  lsikkgklivltGppGsGKtTlakaLaerl...glpvistddllreavpggtdlgel.fqdlllegellf
00462761   1/1  yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr...........
00515801   1/1  ---llIvltGppGsGKtTlaklLaerl...glpfistddllreavpggtplgeeirdlldagellpdeel
00493981   1/1  -kpklilltGppGsGKttlaraLaeel...glpfidaddllrelvg...............egigllfel
00489631   1/1  MkgklillvGppGsGKtTlaraLaell...glpf..iridgddllrellgellgrgigfgfqqgdlleda
00498811   1/1  kPgkiigltGpsGsGKsTlarlLae.l...gvividgddltrelvaggglliglifqdfglfelldrell
00479331   1/1  ap.kli.ltGppGsGKttlakaLaeel...glpfidtddllrklv...........gesirellelagel
00476071   1/1  -kgkiigltGpsGsGKsTlaklLae.lglpvidtddltregvllggpllerirellgegyllfdealdre
00477721   1/1  --kpklilltGppGsGKttlaraLaeel...glpfidtddllrelvgegielilelfd............
00501941   1/1  k...lilltGppGsGKttlaralaeel...glpfidaddllrelv...........gesirelfeaagrl
00499191   1/1  -kgkiigitGpsGsGKsTlaklLaellgatvgdvdgllvgvvfqddfylllpalevlengafll..dlll
00491901   1/1  lmkgkiilltGppGsGKttlakaLaeel...glpfidtddllreaklggelaeliedlfv..........
00493171   1/1  m.gklivllGpsGaGKsTlaklLaeklglivlsvgdttrepregevdgvdyvfvsgelfkelidagelle
00508671   1/1  hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlld.....gddlr...agl
00461621   1/1  mkgmiialtGppGsGKsTlaklLaerl...glpfistddlyrevvergtelgklikdyfdpgalvpd.ll
00480441   1/1  ---rlivllGpsGaGKsTlaklLaellpglivisvgdttrepregevlgvdyvfvdrelfeelivagnll
00459701   1/1  M.pkvillvGppGsGKTTlakaLakrlgekgvkvvvidtddlrreaikqliglglfdedgegalrrreav
00477561   1/1  -kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrralifqdeldlfdedreegfrvpeel
00480501   1/1  M.gklillvGppGsGKtTlaralaellg..gvvvidgddlrralvggl......idgllilfledeaals
00451571   1/1  MsikkgeiiaivGppGsGKsTlaklLakll...glivldgddllreaiglvtqdgelllelide...gil
00493431   1/1  -kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgevrgigyvfqsgalfphlivagnl
00426051   1/1  kpgevialvGpsGsGKSTlakllakelglefidsgdilrdgvdlggesglllrdlrrliglvfqdpilfp
00381441   1/1  --GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdgvdltfls.....reeigyvfq
00484101   1/1  -kgpvigivGpsGsGKTTllraLagllkprggrvav----------------------------------
00513251   1/1  -------lvGppGsGKstlakklaell....gfilidaddlr..........................gq
00480251   1/1  -EdlslavgkgkvialvGkgGvGKTTtaakLaaala----------------------------------
00470731   1/1  -arpltfddvvgqdeakeeleellagllgikkpkvi----------------------------------
00448931   1/1  -LddvslsvepgevialvGpnGsGKTTllnalagll----------------------------------
00483811   1/1  --PkvillsGpPGvGKTtlaaaLakyLksqgldvlvldldellrgllgqpklydlleellelllde....
00468601   1/1  -kgevialvGpnGvGKTTllakLagllapqggkvll----------------------------------
00457311   1/1  mkkgeiigivGpsGsGKSTlarllagllekpgsgvi----------------------------------
00490731   1/1  -dvslsvkkgkvialvGkgGvGKTTlaaklagllak----------------------------------
00469131   1/1  mmkviavtsgkgGvGKTtlaanlaaalaerGkrVll----------------------------------
00509891   1/1  pkvigit..GpsGsGKTTlanaLarllkarglkvavidrdpg----------------------------
00485451   1/1  --skiygdealkdvsleikkllnlsgkpgeiigivG----------------------------------
00475371   1/1  -kgevialvGkgGvGKTTlaanlagllaptggkvll----------------------------------
00373841   1/1  MplggkpkviavtsgkGGvGKTTtaanlAaalaerG----------------------------------
00474061   1/1  mmkviavtsgkGGvGKTtvaanlAaalaelGkrVll----------------------------------
00463151   1/1  M..kiIgltGpiGsGKsTvaklLaekl-------------------------------------------
00513761   1/1  ---kiiaivGkgGsGKTTllnklaglla.dggkvlv----------------------------------


                         -         -         *         -         -         -         -:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
00464421   1/1  lddtelllfalqllfatPladraehleelikpalaagklgaldlivilDRyidsdllafaaqgygrglls
00487061   1/1  pdafdn.ellgellealleggkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllgg
00533501   1/1  lllvfadrygvlrglikpalaegvsvildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilld
00469161   1/1  ellaanragl.relikellaagkgvildrfplsrlayqlsggerqrlaidlegalllerllldepfpdlv
00532471   1/1  lpllevlellaarleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdl
00464411   1/1  valgrygll.glikealaegvivildrvglsdlaypgflsggeqqrvaiarall...pkpdlvllldept
00420081   1/1  slddaallllslqllfaapylslnevidaarvlladefikplpagykvviiDRhplsallvFplarylgg
00478131   1/1  rralleealealkagdvvildgfgrslaarq.........lllellrelgrvvkpdlvifldappevlle
00533151   1/1  lllfddefrglllerleellargpvvildgf............pggllqrealrrll...lrpdlvifld
00478081   1/1  relleealalladgdvvilDgfgrlldarq.........lleelllllleepppdlvifldadpevlleR
00487021   1/1  eirgllkaerlervevllervgllldrippalsgGqgqrvildrallselayqpdvllldeplsgldakl
00475381   1/1  rltvlenvllgllllgglvvildggvrqrlalarallldpdvllldeplllldaalrdlpdlvifldadp
00496571   1/1  lalgrylhl.glilaalaagvgvvldrvglsdlay.gfprtlsglgqrqrvalarallkpdlvifldepp
00486921   1/1  frdelldlllevieellaag.gvildgfplslegaqalra...........llrelgldpdlvifldapp
00515351   1/1  i.......rglllealeellaagkvvildglsggllqrvallral...............lrpdlvifld
00518511   1/1  flilei.fealieggflledrvvlsllayqgvildggglvledrdalrkllpkpdlviyldaspeelleR
00478391   1/1  lfrellideidlllakgkvvildgtnlsealdealrrllr................pdlvifldapleel
00512061   1/1  fralelgllldeiekllakgkvvildgtllgteqreal......................dlvifldapl
00493061   1/1  lllaevrelllevleealaag.gvildgfprtiesaealrallle..............lglppdlvifl
00496061   1/1  vlgll...rerldelielllagg.vvildgf............pldlegalllrealarallpdlvifld
00457851   1/1  fdeldellkerieellaag.gvild............gfpldlegaealreallragplpdlvifldapl
00486891   1/1  vrdllyelllealeaggvvl.dgf.............pldleqaellrellkelglppdlvifldappee
00464591   1/1  vrdlllevikellaaggvvldgfpldleqaellrel................gprpdlviyldasleell
00499331   1/1  llvddevrrlllealdelllaggkvvildgf............pggllqrealrrll...prpdlvilld
00457881   1/1  pdaivrdlllelleelladgkgvildgfprdleqaeal...........rallaelglppdlvifldapl
00472911   1/1  daleagfrqrladlirallakgkvvildgtglsreare.........ellellkelg....pvlviflda
00482721   1/1  frallaellfgdll.alalldgvvydrlrdellaelsggqgdvliiegalllepgllplpdlvifldapp
00516041   1/1  elvpelallfideidellakgkvvild..............gtgrlleldealellg...pdlvifldap
00434401   1/1  ..lreglgidfqlpdaldrellreevlellglgevvivdvydlsggerqr.aralasgpdvlilDgptlg
00489391   1/1  ideiaelllealae.........aegkvvild............gtgldieqrealrelllelprpdlvi
00462761   1/1  ...lglliglvfqdpdllpfltvlenvllpllaaglivivdgt.lllvglrealrkll........glls
00515801   1/1  r.......dlllevirellaag.gvild............gfpldleqaealrallkelglrpdlvifld
00493981   1/1  aeraeflillideidklleegkvvildgtplllealrellreld..................lvvfldap
00489631   1/1  tvlenlalllldeidkaledggvvlldgfdrsqlqrlailrallddp.............pdlvvfldap
00498811   1/1  ielllenlalglalegvildalrrrllelldllgldvvilegplll.sgglrq..........rpdlvif
00479331   1/1  aprillldeilellekggivldd...............ggrnllrallrell...spdlvifldappevl
00476071   1/1  llaallfglelegalldglvyg..vlqdrllerllaagpdvlildgpllldvell....plpdlviflda
00477721   1/1  .rarfrkllielldellaaggvvldlgrtlllrralrellreldl..................vvfldap
00501941   1/1  aprellldeidellekggivildgfllt.....................lrellpepdlvvfldaslevl
00499191   1/1  pdaldrelllelll.alveglvvlldryprllsggqrqrvaia.........dpdvlildgptllldpel
00491901   1/1  .....prellidlikellkag.vvildgtnlgleqlral......................dlvifldap
00493171   1/1  daivigllyergtlldavegalldgfpvlldgalqlllllrel..................llkpdlvil
00508671   1/1  siglilsdedraalrrr.lgevfqelllagrlvvld............gtalglelrdelrellkeaglp
00461621   1/1  irlllerllfldegggflldgfprtleqaealskpavlsggrkqrlalaralavdpe.lildgrllgrrl
00480441   1/1  edaivhgllygtskerieealdaglgvlldgfprglsqaqal..................rlaldlvlll
00459701   1/1  akllldallkalkagggdvvilDgtaltleqrea.........llellkel..glpd.lvvfldtpleel
00477561   1/1  vrellkellarllaeggdvvilDgtnltleqrealrrllkel...........grpd.lviyldapdeel
00480501   1/1  elvlevllealegggnpdvvildgt............nlleedrellrellkrlgrpdlvifldapleel
00451571   1/1  vpdeiviellrealeelda..dgvildgf................prllgqaelllsggkadlvifldap
00493431   1/1  legaevhgllygtskerveealekgllvlldr...............dlsggqqlrvalar...alvvfi
00426051   1/1  gltvglllffldnidlgllirg.deeleaalelaglprvielllegldtlaggggvvlsGgqrqrvalar
00381441   1/1  epallpdltvlenlylglllalllaleegkivildgd.................reraeellellgldad
00484101   1/1  ----------------------------------------------------------------------
00513251   1/1  kqrvalleaalkegylvvvDet............gldraqrlellelardlgrpvlviflatspevlier
00480251   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00483811   1/1  ...................gekipveliiellkdvlvsdpdviilDelpgtnlklqdletlssvaktlnf
00468601   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00463151   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLLP------------
00464421   1/1  lellrelfslllglpkpdlviyldvdpeealeRikkRgrrfEsidleylekvreaYlela----------
00487061   1/1  ldleevkaleelllvlpkpdlviyldadpeelleRlkkRgrdiEeieleyler-----------------
00533501   1/1  eplevldeRlrkrgrlelreldseevlekrlehylellekad.rvvvidaggsleevvee----------
00469161   1/1  ifldaspeelleRllkRgreergrdldteevieerlervrdeylplaelyk-------------------
00532471   1/1  leslllvlplpdlviyldadpeelleRllkRgrdpeeqerlddleevlekylelakadt-----------
00464411   1/1  eeldeRllkRgrllek.leyikkrlehylelaepykddvvvidangsieevveeilk-------------
00420081   1/1  dlslealnallktleelpppdlivlldaspeellkRirkRgrpge-------------------------
00478131   1/1  RllkRgrgseddieeelleallrilepylrllaelperadlviinadlsleevv----------------
00533151   1/1  apleelleRllkrgrlirleddseevlekrlerylklyerliepyeeaddvividas-------------
00478081   1/1  llkRgrrerkddseevlellekrleryepllel.yeeadalviinaglsleevv----------------
00487021   1/1  reelrdllrellpegilpdlvifldadpeelleRllkRgresergepldlleevlekyla----------
00475381   1/1  eelleRllkRgrergeaidleylervreryeelarelaelaea---------------------------
00496571   1/1  teeldeRlrkrlrlgdteevlehrleraeeladrlialyegavvvidasglsleevve------------
00486921   1/1  evlleRllkrgrpddseeeilerlerlreeyeplleeyddavvvidadgsiee-----------------
00515351   1/1  apleelleRllkRddseeeilerleryreeleplleeyddalvvidadgsleevveei------------
00518511   1/1  llkRgr.pleseellekrleayeelaplyelddlvidtsglsleevveeil.kll---------------
00478391   1/1  leRllkrgrhp.eseevleerleryepllepea.adlvidtslsleevveqilel---------------
00512061   1/1  eelleRllkrgrdpleaielrylerlarayeeleplydadlvidnddlsleevveril------------
00493061   1/1  dappevlleRllkRgdseevieerlerllrllerllelykeadd.lividasls----------------
00496061   1/1  apleelleRllkrgrllereddseevlekrlerylelyerliepykkadyvivi----------------
00457851   1/1  eelleRllkrgreplddteevilkrlerlrelyerliepyeeaddvividasls----------------
00486891   1/1  lleRllkRgdseevieerlerllrllerllelykeadd.vividaslsieevv-----------------
00464591   1/1  eRllkrgdseeriekrleelkellerlrelyrelalllpadlvvidaslsieev----------------
00499331   1/1  appeelleRllkrgrldgreddslellekrleryeeltrdlielyeeadrvivi----------------
00457881   1/1  evlleRllkrgddpeealekrlklyepllelyeea.dylividaslsieevveeil--------------
00472911   1/1  dpevlleRllkrgrallreevldrllevrepy....elleeadlvidtsglsleevver-----------
00482721   1/1  evlleRllkRg...gdseeeiekrleryreiaplleaadlvidndgsleevveqile-------------
00516041   1/1  peelleRllkrgldeeaieerlerlreilepleea..ddlvidtanldleevve----------------
00434401   1/1  ldvlldlpdlvifvdhdlevalerrlkrlgrsleeii---------------------------------
00489391   1/1  fldadpeelleRllkrglrperegdseevlekrlerylellerliepyeeaddviv--------------
00462761   1/1  gGqkqrvadlvvlldadpevllaReptr.gldpeteeeleellerleereplygadivi-----------
00515801   1/1  aspeelleRllkrgdseevieerlerllrllerllelyeeadd.vividasgsi----------------
00493981   1/1  peellerllkRpgrfdrrilipeeilerlleilerllaplleaadlvidtsgsleevve-----------
00489631   1/1  leellerllkRdgrteeeilerlarleery.......radlvivtddl...evvekil------------
00498811   1/1  ldappevlleRllkRg....gldeetiekrlelylelaplygaadividndlsle---------------
00479331   1/1  lerllrrgrldllvdeerleellkllekllplykeead.lvidtsglsleevv-----------------
00476071   1/1  ppevlleRllkRg...gdsleeiekrlerylelaplyeeadlvidndglnllsieev-------------
00477721   1/1  leelleRllkRggrfdllielplleelkeilrellplyk.eladlvidtsglsl----------------
00501941   1/1  leRllkRggrfderie.pledleerleilealykeead.lvidtsglsleevve----------------
00499191   1/1  rpl.adlvifldaspeelleRllkRgrlergddleevlerilervrpdylrlieplker-----------
00491901   1/1  levlleRllkrgrdlpelirlrdlerlarlleeledlyee.dlvidtdglsleevveri-----------
00493171   1/1  ldvslevlleRllkRgrd...seevikkrleryleet.plidyydlvivnddleevve------------
00508671   1/1  llvvfldaplevlleR.drrglypeelsgglkqrvaiarplelaaepdlvidtsal--------------
00461621   1/1  lplpdlvifldaspeelleRllkrgrergllvrlddleerilkrdlrdylreiepl--------------
00480441   1/1  dpslevlleRllgrgddteevirkrlerlapeleyyee.lgladvvivnddleealelll----------
00459701   1/1  leRllkrlkrplpgrldrrieeiledlk------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00480501   1/1  lerllkr.gredlslevllkrle.........plyeelil------------------------------
00451571   1/1  levlleRllkrdd.ekilkrleeqkqrvaiarall.kkpailildept.sldevve--------------
00493431   1/1  ldpslelldeRlsgrda.......dtreeirkrlkrlleelgplieydyv--------------------
00426051   1/1  ......pdlllfldeptselleRllkrltrpgldadteeellellerlareyerlie-------------
00381441   1/1  lviilpasleellerldrr---------------------------------------------------
00484101   1/1  ----------------------------------------------------------------------
00513251   1/1  lldrvllldegslvdlgvledllaslepltnregld.lvidlplspeevaaevlkaldkl----------
00480251   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00483811   1/1  pdyvvvltvdleiilkrnlqrsvslpdkkesldkaieelleriepiidlyepld----------------
00468601   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00469131   1/1  ----------------------------------------------------------------------
00509891   1/1  ----------------------------------------------------------------------
00485451   1/1  ----------------------------------------------------------------------
00475371   1/1  ----------------------------------------------------------------------
00373841   1/1  ----------------------------------------------------------------------
00474061   1/1  ----------------------------------------------------------------------
00463151   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------