[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81728.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
  20::97   1.7e-20 46.8% 0047019 00470191 1/1   ic acid-binding proteins                
  18::93   6.5e-19 43.4% 0049455 00494551 1/1   ic acid-binding proteins                
  19::92   1.8e-18 45.9% 0048887 00488871 1/1   ic acid-binding proteins                
  19::97     1e-17 41.8% 0050575 00505751 1/1   ic acid-binding proteins                
  12::92   4.3e-17 42.0% 0051771 00517711 1/1   ic acid-binding proteins                
  15::97   6.8e-17 43.2% 0040675 00406751 1/1   ic acid-binding proteins                
  23::97     2e-16 32.0% 0049427 00494271 1/1   ic acid-binding proteins                
  19::92   2.7e-16 47.3% 0047828 00478281 1/1   ic acid-binding proteins                
  19::98   8.9e-16 40.8% 0052107 00521071 1/1   ic acid-binding proteins                
  28::85   2.6e-14 44.8% 0046451 00464511 1/1   ic acid-binding proteins                
  20::97   1.6e-12 42.9% 0051177 00511771 1/1   ic acid-binding proteins                
  15::92   1.5e-08 33.8% 0038590 00385901 1/1   ic acid-binding proteins                
  19::90   1.6e-05 36.4% 0047715 00477151 1/1   ic acid-binding proteins                
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MWYSGGTAGGFRARRRNVELEAGTVVEGRVVRVVSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEG
00470191   1/1  -------------------lkvGevveGtVvsvtdfgafVdl.ggveGlvhiselsddrvlfdeerlalv
00494551   1/1  -----------------edlkvgeivkGtVvsvtdfgafVdlglgveGlvpiselsddrvedleevlkvg
00488871   1/1  ------------------dlkvgdvvkGtVvsitdfgafVdlgelggveGlvpiselsdkrvedpedvlk
00505751   1/1  ------------------dlkvGdvvtGtVvsvtdfgvfVdlglggveGlvpiselsddlrvedpeevlk
00517711   1/1  -----------pwellledlkvgeivkGtVvsvtdfgafVdlgelggveGlvpiselsddrvedlsdvlk
00406751   1/1  --------------ellellevgdvveGkVv.itdfgvfVdlgelggveglvpiselsllkrvedpsell
00494271   1/1  ----------------------GdivkGkVvkilpglegafVdiglgvegflpiselslellllelslkr
00478281   1/1  ------------------dlkvgevveGtVvsvtdfgafVdlgelegveGlvpiselsddrvedlsdvlk
00521071   1/1  ------------------kpfkgevveGvVtsvtkfgvfVdl.ggvegfvpiselsddrvydfdekllll
00464511   1/1  ---------------------------GtVtsvtdfgafVdlgggveGlvhiselsddllllrvedlsdv
00511771   1/1  -------------------PfkgevveGtVvsvtkfgvfvdl.ggvegfvplselsddrvfdedenllvw
00385901   1/1  --------------yeefklkegeivtGtVvrvtkggvfVdlg.gvegllplsels......pgevlkvg
00477151   1/1  ------------------kdregeivtGtVkrvaraeerggvfvdlggeeegvegllpvseli......p


                         -         -         *         -         -         -         -:140
query           DIVQVLIKGRDAKGRLDLSIKDLTPAPEGGAPPPRPRRLPKQSPEFENKLKSFLRGTGGFGGKGKKGGRK
00470191   1/1  gedpsevlkvGdevevkvlevdlerge-------------------------------------------
00494551   1/1  devkvkvlkvdekgrivLslkkl-----------------------------------------------
00488871   1/1  vgdevevkvlevdkekgrivLS------------------------------------------------
00505751   1/1  vGdevkvkvlsvdpekgrisLSlkkal-------------------------------------------
00517711   1/1  vgdevevkvlsvdkekgrivLS------------------------------------------------
00406751   1/1  .vGdevkvkvlevdkekgrivLslkkl-------------------------------------------
00494271   1/1  vedisdvlkvGqevlvkvlkvdlgnkg-------------------------------------------
00478281   1/1  vgdevevkvlevdkekgrivLS------------------------------------------------
00521071   1/1  vgedlelvlkvgdevrvkvlevdkeegr------------------------------------------
00464511   1/1  lkvgdevevkvlevd-------------------------------------------------------
00511771   1/1  edlelvlkvgdevrvkvlgvdlekgri-------------------------------------------
00385901   1/1  drvkvkvlevdkerkgivlslk------------------------------------------------
00477151   1/1  gevlkvgdrvkvyvlevdke--------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KR--------------------------------------------------------------------
00470191   1/1  ----------------------------------------------------------------------
00494551   1/1  ----------------------------------------------------------------------
00488871   1/1  ----------------------------------------------------------------------
00505751   1/1  ----------------------------------------------------------------------
00517711   1/1  ----------------------------------------------------------------------
00406751   1/1  ----------------------------------------------------------------------
00494271   1/1  ----------------------------------------------------------------------
00478281   1/1  ----------------------------------------------------------------------
00521071   1/1  ----------------------------------------------------------------------
00464511   1/1  ----------------------------------------------------------------------
00511771   1/1  ----------------------------------------------------------------------
00385901   1/1  ----------------------------------------------------------------------
00477151   1/1  ----------------------------------------------------------------------