[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81794.1


[Show Plain Result]

## Summary of Sequence Search
   1::125
   2::118  2.9e-32 47.4% 0052966 00529661 1/1   sterase/thiol ester dehydrase-isomerase 
   2::118  8.2e-31 47.0% 0051338 00513381 1/1   sterase/thiol ester dehydrase-isomerase 
   2::121  2.5e-30 47.1% 0051233 00512331 1/1   sterase/thiol ester dehydrase-isomerase 
   2::118  3.6e-30 50.9% 0050275 00502751 1/1   sterase/thiol ester dehydrase-isomerase 
   2::121  2.9e-29 47.1% 0052965 00529651 1/1   sterase/thiol ester dehydrase-isomerase 
   3::121  6.6e-24 41.8% 0053001 00530011 1/1   sterase/thiol ester dehydrase-isomerase 
   2::113  3.4e-22 39.4% 0048889 00488891 1/1   sterase/thiol ester dehydrase-isomerase 
   2::111  4.8e-22 39.8% 0048478 00484781 1/1   sterase/thiol ester dehydrase-isomerase 
   2::107  1.6e-21 42.0% 0052559 00525591 1/1   sterase/thiol ester dehydrase-isomerase 
   2::109  2.5e-21 39.0% 0051590 00515901 1/1   sterase/thiol ester dehydrase-isomerase 
   2::117  4.3e-21 40.2% 0047466 00474661 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  5.1e-21 37.9% 0053213 00532131 1/1   sterase/thiol ester dehydrase-isomerase 
   3::109  6.5e-21 38.6% 0050180 00501801 1/1   sterase/thiol ester dehydrase-isomerase 
   2::111  1.2e-20 40.6% 0050179 00501791 1/1   sterase/thiol ester dehydrase-isomerase 
   2::112  2.3e-20 42.9% 0047497 00474971 1/1   sterase/thiol ester dehydrase-isomerase 
   2::118  3.7e-20 42.2% 0052350 00523501 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  5.1e-20 34.7% 0046019 00460191 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  8.5e-20 41.2% 0051839 00518391 1/1   sterase/thiol ester dehydrase-isomerase 
   2::88     1e-19 44.7% 0048813 00488131 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  1.6e-19 36.2% 0051794 00517941 1/1   sterase/thiol ester dehydrase-isomerase 
   2::118  3.6e-19 41.0% 0049396 00493961 1/1   sterase/thiol ester dehydrase-isomerase 
   1::116  7.9e-19 37.3% 0052780 00527801 1/1   sterase/thiol ester dehydrase-isomerase 
   1::120  2.4e-18 33.9% 0052351 00523511 1/1   sterase/thiol ester dehydrase-isomerase 
   2::107  2.7e-18 38.1% 0052592 00525921 1/1   sterase/thiol ester dehydrase-isomerase 
   2::112  5.2e-18 35.0% 0051358 00513581 1/1   sterase/thiol ester dehydrase-isomerase 
   4::121  1.6e-17 37.8% 0049325 00493251 1/1   sterase/thiol ester dehydrase-isomerase 
   2::120  1.9e-14 32.1% 0041428 00414281 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  1.2e-13 27.2% 0053052 00530521 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  1.7e-13 34.8% 0051494 00514941 1/1   sterase/thiol ester dehydrase-isomerase 
   1::121  3.9e-11 29.2% 0052881 00528811 1/1   sterase/thiol ester dehydrase-isomerase 
   5::110  5.9e-11 32.7% 0049564 00495641 1/1   sterase/thiol ester dehydrase-isomerase 
   9::122  7.8e-07 29.4% 0053021 00530211 1/1   sterase/thiol ester dehydrase-isomerase 
   9::109  0.00012 28.0% 0051892 00518921 1/1   sterase/thiol ester dehydrase-isomerase 
  21::86   0.00016 24.2% 0044191 00441911 1/1   sterase/thiol ester dehydrase-isomerase 
   1::88   0.00026 29.4% 0052337 00523371 1/1   sterase/thiol ester dehydrase-isomerase 
   9::114   0.0003 20.6% 0051977 00519771 1/1   sterase/thiol ester dehydrase-isomerase 
   1::125


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEARTLELVFPEHTNPLGAAFGGFVLGLMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
00529661   1/1  -gvvlrllvrpehlnphgivhgGvlltlldeaagiaalsllgarvvtvsldnidFlrPvrvGdvltaear
00513381   1/1  -evedgrvvlrllvrpedtnalGtvhgGvlltlldeaagiaaarhaggrvvtasvdninFlkPvrvGdvl
00512331   1/1  -elvevsdgrvvlrlpvrpehtnphGivhGGvllallDeaagiaaarhlggrvvtvsldnidFlrPvrvG
00502751   1/1  -lelvevedgrvtlrllvrpedtnalGivhgGvllalldeaagiaaarhaggrvvtasldsidFlrpvrv
00529651   1/1  -epleedgevvlrlpvrpehlnphGivhGGvlltlldeaagiaaaslaggrvvtvsldnidFlrpvrvGd
00530011   1/1  --allperypfllvdpfaellgdirivevedgrvvlrlpvrpghlnphgivhGGvlaalldeaagiaala
00488891   1/1  -rvvlrlpvrprhlnppGtvhGGalaalaDeaaglaallllpelggrvvtasln.inflrpvrvG.tlta
00484781   1/1  -rvvlrlpvrpehlnppGtvhGGalaalaDtaaglaalallgegvvtvtvdlninflrpvrvG.tltaea
00525591   1/1  -lpglellpallrallagppfarllgielvevgdgevvlrlpvrpehtnppGivhGGvlaallDeaagla
00515901   1/1  -rvvlrlpvrprllnppGtvhGGalatlaDtaaglaalallgegvvtvtvdlninflrparvgd.ltaea
00474661   1/1  -evtlrlpvepahvlnpfgivhGgllaalldtaagiaa...pgklvvtasld.inFlrpvrvGdtltaea
00532131   1/1  lPlrlllllllarplldlpadgpftlrirVrpedtDanGhvnngvylrwldeartallrrlglldllesg
00501801   1/1  --dmlllpellaallallaldpfarllgieivevgdgrvvlrlpvrprhlnppGtvhGGalaalaDtaag
00501791   1/1  -dmllleellarllallalipfarllgielvevgdgrvvlrlpvrprhlnplGtvhGGalaalaDtaagl
00474971   1/1  -ripfarllgiriveledgrvvlrlpvrpehlnppgivhGGalaallDeaaglaallllg..vvtasld.
00523501   1/1  -evvlrlpvrpehlnplgtvhGGalaallDeaagiaalrllggklvvtasld.inFlrpvrvGdtltaea
00460191   1/1  mdpftlrirVrpedtDanghvnngrylswfdearteflrelglglllaallaeglvglvvvsle.idylr
00518391   1/1  ddplmsdlpftlrirVrpedtDanghvnngvylswfdearteflralg.laalrasglglvvvsle.idf
00488131   1/1  -rvvlrlpvrpehlnppgtvhGGalaaladeaaglaalll.gkrvvtasld.idflrpvrvGdtltaear
00517941   1/1  dlpftlrirVrpsdtDanghvnngvylswfdeartellerlgldllasglglvvvsle.idylrpvrlgd
00493961   1/1  -rvvlrlpvrpr.lnplGtvhGGalaalaDlaaglaallllgeegkrvvtvdln.inflrpar.Gd.lta
00527801   1/1  dlpftlrirVrpedtDanghvnngvylswfdearteflrrlgldllaaglglvvvsle.idylrpvrlgd
00523511   1/1  lsdlvftleirVrpsdtDanghvnngvylsyfeearteflrrlgldlarglglvvaeleidylrpvrlgd
00525921   1/1  -llgdeiteldpgkfatltldvnpehldnehgivhGgllfaladqaaaaal....nglvavtgslnvrFl
00513581   1/1  -rvvlrlpvrprllnppgtvhGGalaalaDlaaglaallllgegvvvvtvdlnidflrparvgdtltaea
00493251   1/1  ---dpftleirVrpedtDanghvnngrylsyfdearteflrelglgiaalrksglglvvvele.idylrp
00414281   1/1  -pfvlelrvrpgdtDanghvnngvylelldeartellrelglal..allegglglvvaeleidyrrpvrl
00530521   1/1  llmslvftlrirVrfgdtDaaGiVyhanylrwfeeareeflralglpyadllpgvlileeeggiglpvve
00514941   1/1  fpfvleirVrfedtDaaGhvnngvylryfeearteflrelglsyaallaeglglvvvele.idylaparl
00528811   1/1  lmdypfeleirVrfedtDaaGhvnnanylryfeearteflaealgldyaelee.glalvvveleidylrp
00495641   1/1  ----eltaplapnlnhhgtvfGGsiatladlagggaalllldeaglggdvvtad.lninflaPvtggvta
00530211   1/1  --------ldltftleirVrpsdtDanghvnnavYlrlfeeartallerlGldlaalaesgiglvvvelh
00518921   1/1  --------vplllvineildllphrypfllvdglyfedlevGevlsgtrtvteedialfarltgdpnpiH
00441911   1/1  --------------------fpgvlliEaiaqglltlalllglllellgglgvllgvdkvrflkpvlpGd
00523371   1/1  ltaeleltVteeltapflglggllsVlaTpalvalmElaaleallpfleegettvgtevnvkHlaptpvG
00519771   1/1  --------tnplhldeeafggrivhGgltfslalglsvlalp....navavlgyqslrflaPvfaGDtLt


                         -         -         *         -         -         -         -:140
query           VVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVEAHAGTD---------------
00529661   1/1  vvkvgrssivvevevyvedlltgegrlvat.atftfvavdedgkPvpv----------------------
00513381   1/1  eaearvvkvgrssmevevevyaedllsletgegrlvatatftfvavde----------------------
00512331   1/1  dvltaearvvrvgrssavvevevyvedlldgegklva.tatftfvavdetg-------------------
00502751   1/1  Gdvlevearvvrvgrssmevevevyvedlldgdgk.lvaeatftfvav----------------------
00529651   1/1  vltaearvvkvgrssavvevevyvedlldgegrlva.tatftfvavdlled-------------------
00530011   1/1  llggrvvtasld.idflrpvrvGdtltaearvvrvgrrsavvevevydd..-------------------
00488891   1/1  earvvrvgrrsavvevevy.....dedge.lvatatgtfvvld---------------------------
00484781   1/1  rvvrvgrrlavvevevy.....dedgk.lvatatgtfvvld-----------------------------
00525591   1/1  alallgggrvvtvsln.inflrparlGdtltararvv---------------------------------
00515901   1/1  rvvrvgrrlavvevevtdd..gk.....lvatatgtfvv-------------------------------
00474661   1/1  rvvkvvgrslv.vevevy.......degklvatatgtfvavdkk..k-----------------------
00532131   1/1  lglvvvele.idylrpvrlgdvltvetrvvrvgrssltveveifred....-------------------
00501801   1/1  laalallgegvvvvtvdlninflrpvrvG.tltaearvv-------------------------------
00501791   1/1  aalallgaggrvvtasln.inflrparvG.tltaearvvrv-----------------------------
00474971   1/1  inflrpvrvGdvltaearvvrvgrrsavvevevtde..gk..----------------------------
00523501   1/1  rvvkvgrrsavvevevyde....edgklvatatgt..........krl----------------------
00460191   1/1  pvrlgdvlevetrvvkvgrksltleqeifnedll..gdgelvataettlva-------------------
00518391   1/1  lrpvrlgdvltvetrvvrvgrssltvevevfre.....gdgelvataettf-------------------
00488131   1/1  vvrvgrrsavvevevyde----------------------------------------------------
00517941   1/1  vltvetrvvevgrtsltvevevfren....gdgelvataettlvavdletg-------------------
00493961   1/1  earvddelldailellvkvgrrlavvevevy.....dedgklvat..t----------------------
00527801   1/1  vltvetrvvrvgrtsltveqeifred....edgelvataettlvav------------------------
00523511   1/1  elevetrvvklgrssltleveifr.......dgelvatgettlvavd.tg--------------------
00525921   1/1  rpvkpGdtlvaearvlkvggrsvvvevevyne.....---------------------------------
00513581   1/1  rvvrlgrrlqavvevevt.......ddgklvatatgtfvv.p----------------------------
00493251   1/1  vrlgdvlevetrvvkvgrksltleqeifred......gelvataettlvav-------------------
00414281   1/1  gdvltvetrvlkiggrsltveveirdledge.....lvaeaettfvlvdl--------------------
00530521   1/1  leidflrPvrlgDlltvelrverlggssftfeyeilrdg.......elvae-------------------
00514941   1/1  gdvlevrtrvvelgrssltfeyeifr.......dgellaegettlvavd.t-------------------
00528811   1/1  vrlgdtltvetrvlelgrssltfeyeifr.......dgelvaegettlvcv-------------------
00495641   1/1  vaelpeeflarllrrgrrrvvvevevyd....dg...klv------------------------------
00530211   1/1  irYlrelrlgdelevrtrvlglggksltlehellr.....addgellatget------------------
00518921   1/1  fdpefakapgfpgviahgmltaalalallvelpgd.avl-------------------------------
00441911   1/1  tlrlevevlevrrgiv------------------------------------------------------
00523371   1/1  etvtvtaelvevegrrlv----------------------------------------------------
00519771   1/1  aelevlslrerpgtgivtlrttvtnq.....dgevVlefrrtvl--------------------------