[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81826.1


[Show Plain Result]

## Summary of Sequence Search
   1::443
   1::319  4.3e-50 36.2% 0037441 00374411 1/1   AD(P)-binding domain                    
   1::320  1.8e-48 33.3% 0043577 00435771 1/1   AD(P)-binding domain                    
   1::319  1.3e-47 33.3% 0049150 00491501 1/1   AD(P)-binding domain                    
 108::320  4.1e-47 42.4% 0048199 00481992 2/2   AD(P)-binding domain                    
   1::197  5.2e-46 38.5% 0047068 00470681 1/2   AD(P)-binding domain                    
   1::346    5e-45 36.5% 0040049 00400491 1/1   AD(P)-binding domain                    
   1::362  8.3e-45 34.3% 0047022 00470221 1/1   AD(P)-binding domain                    
   1::265  1.8e-43 34.0% 0050363 00503631 1/1   AD(P)-binding domain                    
   3::320  2.2e-41 30.0% 0045870 00458701 1/1   AD(P)-binding domain                    
   1::290  3.5e-41 32.5% 0046274 00462741 1/1   AD(P)-binding domain                    
   1::318  9.5e-41 31.2% 0036092 00360921 1/1   AD(P)-binding domain                    
   1::190  2.5e-39 44.4% 0046750 00467501 1/2   AD(P)-binding domain                    
   1::316  3.5e-38 36.6% 0040035 00400351 1/1   AD(P)-binding domain                    
 147::316  1.2e-37 38.0% 0036300 00363002 2/2   AD(P)-binding domain                    
 146::323    1e-36 41.1% 0047270 00472702 2/2   AD(P)-binding domain                    
 148::316  9.2e-36 41.3% 0048865 00488652 2/2   AD(P)-binding domain                    
 115::241  1.3e-35 51.2% 0038285 00382852 2/2   AD(P)-binding domain                    
   1::360  1.5e-35 34.6% 0052032 00520321 1/1   AD(P)-binding domain                    
   1::316    2e-35 33.6% 0035989 00359891 1/1   AD(P)-binding domain                    
   1::207  3.3e-35 35.7% 0048583 00485831 1/2   AD(P)-binding domain                    
 150::320  4.2e-35 34.7% 0048364 00483642 2/2   AD(P)-binding domain                    
   2::320  4.5e-35 34.3% 0049990 00499901 1/1   otide-binding domain                    
 115::242  9.8e-35 43.8% 0048866 00488662 2/2   AD(P)-binding domain                    
   1::318  1.1e-34 29.1% 0047029 00470291 1/1   AD(P)-binding domain                    
   1::283  3.6e-34 34.7% 0052600 00526001 1/1   AD(P)-binding domain                    
 147::320  1.3e-33 40.7% 0046514 00465142 2/2   AD(P)-binding domain                    
 150::320  1.8e-33 43.6% 0050960 00509602 2/2   AD(P)-binding domain                    
 145::319  9.3e-33 39.6% 0050148 00501482 2/2   AD(P)-binding domain                    
 149::319  2.9e-32 42.6% 0037643 00376432 2/2   AD(P)-binding domain                    
   5::299  4.3e-32 31.7% 0040660 00406601 1/1   AD(P)-binding domain                    
 148::320  8.8e-32 41.8% 0038074 00380742 2/2   AD(P)-binding domain                    
 109::283  1.6e-31 43.7% 0046344 00463442 2/2   AD(P)-binding domain                    
 148::293  2.6e-31 42.4% 0036459 00364592 2/2   otide-binding domain                    
   1::206  7.3e-31 33.5% 0047564 00475641 1/2   AD(P)-binding domain                    
 151::320    8e-31 43.4% 0046760 00467602 2/2   AD(P)-binding domain                    
 148::322  1.2e-30 45.4% 0047133 00471332 2/2   AD(P)-binding domain                    
   1::243  2.7e-30 32.1% 0048016 00480161 1/1   otide-binding domain                    
   5::318  2.8e-30 33.0% 0041341 00413411 1/1   AD(P)-binding domain                    
   1::318  3.1e-30 31.3% 0047327 00473271 1/1   otide-binding domain                    
   2::243  3.5e-30 32.6% 0046156 00461561 1/1   otide-binding domain                    
 150::316  4.5e-30 36.3% 0048494 00484942 2/2   AD(P)-binding domain                    
   1::283  6.3e-30 31.6% 0048356 00483561 1/1   AD(P)-binding domain                    
 120::242  1.9e-29 46.7% 0036301 00363012 2/2   AD(P)-binding domain                    
 147::320  3.1e-29 42.2% 0053321 00533212 2/2   AD(P)-binding domain                    
 121::240  1.2e-28 41.2% 0047565 00475652 2/2   AD(P)-binding domain                    
 116::243  1.4e-28 44.2% 0048584 00485842 2/2   AD(P)-binding domain                    
 136::320  1.4e-28 39.2% 0045518 00455182 2/2   AD(P)-binding domain                    
 122::241    2e-28 39.2% 0048365 00483652 2/2   AD(P)-binding domain                    
   1::280  2.6e-28 28.2% 0046128 00461281 1/1   AD(P)-binding domain                    
 122::242  3.3e-28 40.9% 0053322 00533222 2/2   AD(P)-binding domain                    
 136::320  4.2e-28 43.9% 0040688 00406882 2/2   AD(P)-binding domain                    
 120::242  4.5e-28 43.5% 0048009 00480092 2/2   AD(P)-binding domain                    
 150::278  5.5e-28 43.4% 0047909 00479092 2/2   )-binding Rossmann-fold domains         
 116::244  5.6e-28 45.1% 0050961 00509612 2/2   AD(P)-binding domain                    
 119::241  7.1e-28 41.9% 0036654 00366542 2/2   AD(P)-binding domain                    
 116::244  9.5e-28 33.9% 0042446 00424462 2/2   AD(P)-binding domain                    
 147::319  2.2e-27 40.4% 0045797 00457972 2/2   AD(P)-binding domain                    
 125::267  2.5e-27 41.6% 0045519 00455192 2/2   AD(P)-binding domain                    
 146::316  6.9e-27 43.6% 0046416 00464162 2/2   AD(P)-binding domain                    
 120::240  9.8e-27 44.2% 0036889 00368892 2/2   AD(P)-binding domain                    
 146::319  1.1e-26 37.8% 0044098 00440982 2/2   AD(P)-binding domain                    
 151::366  1.9e-26 32.0% 0048771 00487712 2/2   AD(P)-binding domain                    
 117::242  2.3e-26 40.5% 0040619 00406192 2/2   AD(P)-binding domain                    
 123::242  2.8e-26 42.1% 0048045 00480452 2/2   AD(P)-binding domain                    
 322::442  3.5e-26 34.7% 0041394 00413941 1/1   AD-linked reductases, dimerisation (C-t 
 119::242  1.4e-25 45.2% 0048200 00482002 2/2   AD(P)-binding domain                    
 122::241  1.8e-25 50.0% 0045798 00457982 2/2   AD(P)-binding domain                    
 119::240  1.9e-25 43.4% 0041940 00419402 2/2   AD(P)-binding domain                    
 147::319  2.7e-25 36.3% 0049003 00490032 2/2   AD(P)-binding domain                    
 125::243  3.9e-25 39.5% 0048108 00481082 2/2   AD(P)-binding domain                    
 126::242  5.6e-25 41.2% 0046972 00469722 2/2   AD(P)-binding domain                    
 127::242  5.8e-25 38.4% 0038449 00384492 2/2   AD(P)-binding domain                    
 150::319  7.9e-25 37.4% 0052926 00529262 2/2   AD(P)-binding domain                    
 147::320  1.7e-24 40.4% 0040602 00406022 2/2   AD(P)-binding domain                    
 136::319  2.5e-24 37.4% 0046270 00462702 2/2   AD(P)-binding domain                    
 115::241    3e-24 39.0% 0044705 00447052 2/2   AD(P)-binding domain                    
 136::315  5.9e-24 34.9% 0039664 00396642 2/2   AD(P)-binding domain                    
 121::242    2e-23 43.9% 0046973 00469732 2/2   AD(P)-binding domain                    
 152::283  2.7e-23 43.5% 0045881 00458812 2/2   AD(P)-binding domain                    
 117::242  3.7e-23 39.8% 0047271 00472712 2/2   AD(P)-binding domain                    
   5::248  8.4e-23 31.9% 0044413 00444131 1/1   AD(P)-binding domain                    
 117::242  1.1e-22 34.1% 0036016 00360162 2/2   AD(P)-binding domain                    
 148::315  5.8e-22 34.2% 0047712 00477122 2/2   AD(P)-binding domain                    
   1::135  9.8e-22 32.3% 0048865 00488651 1/2   AD(P)-binding domain                    
 120::242  1.1e-21 37.3% 0049679 00496792 2/2   AD(P)-binding domain                    
 150::315  1.3e-21 40.1% 0046834 00468342 2/2   AD(P)-binding domain                    
 129::243  1.8e-21 43.8% 0046761 00467612 2/2   AD(P)-binding domain                    
 149::322  2.2e-21 43.1% 0050927 00509272 2/2   AD(P)-binding domain                    
 147::320  2.9e-21 33.6% 0046057 00460572 2/2   otide-binding domain                    
   3::117  3.7e-21 35.7% 0048364 00483641 1/2   AD(P)-binding domain                    
   1::138  2.1e-20 34.6% 0045797 00457971 1/2   AD(P)-binding domain                    
 151::285  3.4e-20 39.7% 0048607 00486072 2/2   AD(P)-binding domain                    
 121::282  3.7e-20 31.5% 0037437 00374372 2/2   )-binding Rossmann-fold domains         
   5::143    6e-20 36.6% 0048607 00486071 1/2   AD(P)-binding domain                    
   1::135  3.2e-19 31.6% 0049222 00492221 1/2   AD(P)-binding domain                    
 151::283  6.9e-19 40.8% 0046579 00465792 2/2   AD(P)-binding domain                    
 152::280  3.8e-18 36.3% 0047682 00476822 2/2   AD(P)-binding domain                    
   1::126  4.4e-18 32.5% 0036300 00363001 1/2   AD(P)-binding domain                    
 191::317    9e-18 38.4% 0046446 00464463 3/3   AD(P)-binding domain                    
   1::136  1.1e-17 28.7% 0052963 00529631 1/2   AD(P)-binding domain                    
   3::144  1.2e-17 30.3% 0050960 00509601 1/2   AD(P)-binding domain                    
 325::440  1.2e-17 29.8% 0036890 00368901 1/1   AD-linked reductases, dimerisation (C-t 
   1::134  1.4e-17 32.0% 0047270 00472701 1/2   AD(P)-binding domain                    
 115::242  2.3e-17 33.9% 0038468 00384682 2/2   AD(P)-binding domain                    
   1::131  3.1e-17 29.0% 0044098 00440981 1/2   AD(P)-binding domain                    
 150::317  3.7e-17 34.9% 0045795 00457952 2/2   otide-binding domain                    
   1::144  5.1e-17 28.2% 0036459 00364591 1/2   otide-binding domain                    
 136::246  5.7e-17 37.8% 0049222 00492222 2/2   AD(P)-binding domain                    
   3::138  7.4e-17 32.3% 0050927 00509271 1/2   AD(P)-binding domain                    
   1::140  8.4e-17 30.4% 0052313 00523131 1/2   AD(P)-binding domain                    
 323::445  1.6e-16 26.4% 0041887 00418871 1/1   AD-linked reductases, dimerisation (C-t 
 148::268    2e-16 35.5% 0052313 00523132 2/2   AD(P)-binding domain                    
 146::297  2.1e-16 27.5% 0050443 00504431 1/1   )-binding Rossmann-fold domains         
 146::374  2.6e-16 25.0% 0052963 00529632 2/2   AD(P)-binding domain                    
 323::443  4.6e-16 27.7% 0039504 00395041 1/1   AD-linked reductases, dimerisation (C-t 
   2::136  1.2e-15 34.4% 0050364 00503641 1/2   AD(P)-binding domain                    
   1::135  1.5e-15 30.8% 0047141 00471411 1/2   otide-binding domain                    
   2::138  1.9e-15 29.6% 0037643 00376431 1/2   AD(P)-binding domain                    
   5::142  2.4e-15 30.4% 0052911 00529111 1/2   AD(P)-binding domain                    
 323::443  2.5e-15 28.8% 0041023 00410231 1/1   AD-linked reductases, dimerisation (C-t 
   1::112  5.7e-15 29.9% 0036889 00368891 1/2   AD(P)-binding domain                    
 146::295  5.7e-15 31.5% 0047141 00471412 2/2   otide-binding domain                    
   1::114  7.7e-15 31.0% 0048866 00488661 1/2   AD(P)-binding domain                    
 150::279  1.1e-14 30.8% 0046357 00463571 1/1   )-binding Rossmann-fold domains         
 147::247  1.2e-14 42.0% 0048807 00488072 2/2   otide-binding domain                    
   3::149  1.3e-14 28.3% 0046834 00468341 1/2   AD(P)-binding domain                    
   1::114  1.5e-14 30.3% 0048009 00480091 1/2   AD(P)-binding domain                    
   1::114  3.1e-14 30.3% 0053322 00533221 1/2   AD(P)-binding domain                    
   1::124  3.6e-14 31.0% 0038074 00380741 1/2   AD(P)-binding domain                    
   3::125  6.2e-14 25.6% 0048494 00484941 1/2   AD(P)-binding domain                    
   1::126  1.7e-13 28.6% 0048807 00488071 1/2   otide-binding domain                    
 145::253    3e-13 33.3% 0045481 00454812 2/2    N-terminal domain                      
   1::139  3.4e-13 30.5% 0050148 00501481 1/2   AD(P)-binding domain                    
   1::124  4.1e-13 29.2% 0045519 00455191 1/2   AD(P)-binding domain                    
   1::149  4.1e-13 29.9% 0052926 00529261 1/2   AD(P)-binding domain                    
 321::441  5.1e-13 26.5% 0036655 00366551 1/1   AD-linked reductases, dimerisation (C-t 
   1::115  5.8e-13 30.3% 0042446 00424461 1/2   AD(P)-binding domain                    
   1::115  6.9e-13 28.0% 0048584 00485841 1/2   AD(P)-binding domain                    
 321::443  1.1e-12 26.1% 0045533 00455331 1/1   AD-linked reductases, dimerisation (C-t 
   1::114  1.6e-12 28.1% 0048045 00480451 1/2   AD(P)-binding domain                    
 131::284  1.6e-12 28.7% 0053383 00533831 1/1   )-binding Rossmann-fold domains         
   2::137  1.7e-12 27.2% 0047909 00479091 1/2   )-binding Rossmann-fold domains         
   1::114    4e-12 26.3% 0048200 00482001 1/2   AD(P)-binding domain                    
   1::114  5.9e-12 29.6% 0038449 00384491 1/2   AD(P)-binding domain                    
 150::247  1.2e-11 33.3% 0050364 00503642 2/2   AD(P)-binding domain                    
   1::132  1.3e-11 30.1% 0045518 00455181 1/2   AD(P)-binding domain                    
   1::112  1.3e-11 27.8% 0047565 00475651 1/2   AD(P)-binding domain                    
 321::440  1.8e-11 26.7% 0040604 00406041 1/1   AD-linked reductases, dimerisation (C-t 
   1::121  2.2e-11 30.9% 0040688 00406881 1/2   AD(P)-binding domain                    
 149::250  2.6e-11 23.5% 0044559 00445591 1/1   )-binding Rossmann-fold domains         
   1::124  4.3e-11 25.4% 0047712 00477121 1/2   AD(P)-binding domain                    
   3::115  4.4e-11 30.9% 0046761 00467611 1/2   AD(P)-binding domain                    
 152::297  5.5e-11 32.1% 0052911 00529112 2/2   AD(P)-binding domain                    
   1::114  7.4e-11 29.7% 0047271 00472711 1/2   AD(P)-binding domain                    
   1::132  7.8e-11 25.6% 0046514 00465141 1/2   AD(P)-binding domain                    
   1::113    8e-11 31.6% 0036654 00366541 1/2   AD(P)-binding domain                    
   2::113  8.8e-11 28.7% 0048365 00483651 1/2   AD(P)-binding domain                    
   1::116    9e-11 34.0% 0048108 00481081 1/2   AD(P)-binding domain                    
   1::114  9.2e-11 29.2% 0046972 00469721 1/2   AD(P)-binding domain                    
   1::114  1.1e-10 26.8% 0049679 00496791 1/2   AD(P)-binding domain                    
   3::114  1.3e-10 33.0% 0046973 00469731 1/2   AD(P)-binding domain                    
   1::113  1.7e-10 30.6% 0045798 00457981 1/2   AD(P)-binding domain                    
   1::115    2e-10 30.7% 0050961 00509611 1/2   AD(P)-binding domain                    
   1::122  2.5e-10 29.3% 0046416 00464161 1/2   AD(P)-binding domain                    
   3::141  3.6e-10 27.1% 0045795 00457951 1/2   otide-binding domain                    
   1::129  3.8e-10 29.3% 0046579 00465791 1/2   AD(P)-binding domain                    
 116::240  4.9e-10 33.7% 0052964 00529642 2/2   AD(P)-binding domain                    
   1::114  6.8e-10 34.4% 0036301 00363011 1/2   AD(P)-binding domain                    
 150::242  6.9e-10 30.7% 0047276 00472761 1/1   )-binding Rossmann-fold domains         
   3::112  8.8e-10 24.5% 0041940 00419401 1/2   AD(P)-binding domain                    
   1::123  1.8e-09 24.8% 0047133 00471331 1/2   AD(P)-binding domain                    
   1::128    4e-09 28.1% 0053321 00533211 1/2   AD(P)-binding domain                    
 321::439  4.7e-09 27.0% 0040690 00406901 1/1   AD-linked reductases, dimerisation (C-t 
 149::244  6.5e-09 28.2% 0047992 00479921 1/1   )-binding Rossmann-fold domains         
   6::125  6.6e-09 28.2% 0045881 00458811 1/2   AD(P)-binding domain                    
 150::288  6.7e-09 26.2% 0047278 00472782 2/2   )-binding Rossmann-fold domains         
 321::441  7.6e-09 26.5% 0050928 00509281 1/1   AD-linked reductases, dimerisation (C-t 
   2::117  2.1e-08 27.0% 0048771 00487711 1/2   AD(P)-binding domain                    
   5::119  2.4e-08 32.2% 0039664 00396641 1/2   AD(P)-binding domain                    
   1::133    4e-08 34.0% 0040602 00406021 1/2   AD(P)-binding domain                    
 142::252  4.3e-08 34.1% 0048687 00486871 1/1    N-terminal domain                      
   1::119  4.8e-08 32.2% 0046446 00464461 1/3   AD(P)-binding domain                    
 321::439  5.1e-08 27.8% 0037510 00375101 1/1   AD-linked reductases, dimerisation (C-t 
 321::436  5.1e-08 27.7% 0038076 00380761 1/1   AD-linked reductases, dimerisation (C-t 
   1::119  8.8e-08 29.9% 0049003 00490031 1/2   AD(P)-binding domain                    
   1::113  1.3e-07 25.8% 0044705 00447051 1/2   AD(P)-binding domain                    
   1::119  1.3e-07 27.6% 0046270 00462701 1/2   AD(P)-binding domain                    
   1::119  1.4e-07 31.5% 0047682 00476821 1/2   AD(P)-binding domain                    
   1::113  1.6e-07 30.2% 0038285 00382851 1/2   AD(P)-binding domain                    
   1::128  2.4e-07 25.8% 0046760 00467601 1/2   AD(P)-binding domain                    
 143::249  2.8e-07 28.9% 0042534 00425341 1/1   )-binding Rossmann-fold domains         
   2::115  8.4e-07 30.4% 0040619 00406191 1/2   AD(P)-binding domain                    
 147::258  8.7e-07 33.0% 0042342 00423422 2/2   )-binding Rossmann-fold domains         
 150::247  1.1e-06 23.6% 0048227 00482271 1/1   )-binding Rossmann-fold domains         
   1::127  1.5e-06 24.8% 0046057 00460571 1/2   otide-binding domain                    
 136::184  2.1e-06 42.9% 0046446 00464462 2/3   AD(P)-binding domain                    
 321::436  2.3e-06 26.8% 0045520 00455201 1/1   AD-linked reductases, dimerisation (C-t 
 150::263  4.2e-06 30.1% 0045243 00452431 1/1   )-binding Rossmann-fold domains         
   2::114  1.2e-05 22.1% 0038468 00384681 1/2   AD(P)-binding domain                    
 320::439  1.2e-05 25.9% 0035130 00351301 1/1   AD-linked reductases, dimerisation (C-t 
 146::240  1.5e-05 21.7% 0046673 00466731 1/1   )-binding Rossmann-fold domains         
 150::247  3.1e-05 27.3% 0042340 00423401 1/1   )-binding Rossmann-fold domains         
 150::297  3.6e-05 24.8% 0048102 00481021 1/1   )-binding Rossmann-fold domains         
 131::242  3.8e-05 22.3% 0053172 00531721 1/1   )-binding Rossmann-fold domains         
 321::441  9.9e-05 25.6% 0038450 00384501 1/1   AD-linked reductases, dimerisation (C-t 
 132::251  0.00013 28.3% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
   1::103  0.00014 29.8% 0048199 00481991 1/2   AD(P)-binding domain                    
 150::322  0.00019 21.7% 0038784 00387841 1/1   )-binding Rossmann-fold domains         
 150::178  0.00026 37.9% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
 148::178  0.00047 32.3% 0036785 00367852 2/2   )-binding Rossmann-fold domains         
 149::297  0.00054 24.2% 0035535 00355351 1/1   )-binding Rossmann-fold domains         
 150::283  0.00056 25.9% 0048035 00480351 1/1   )-binding Rossmann-fold domains         
 150::264  0.00087 32.5% 0036664 00366641 1/1   )-binding Rossmann-fold domains         
 149::253  0.00089 25.0% 0052837 00528371 1/1   )-binding Rossmann-fold domains         
 149::253   0.0009 31.6% 0047521 00475211 1/1    N-terminal domain                      
   2::118    0.019 25.0% 0037437 00374371 1/2   )-binding Rossmann-fold domains         
 198::247    0.028 36.7% 0047068 00470682 2/2   AD(P)-binding domain                    
   2::114    0.045 27.1% 0036016 00360161 1/2   AD(P)-binding domain                    
 191::247    0.047 38.9% 0046750 00467502 2/2   AD(P)-binding domain                    
   2::112     0.17 28.2% 0052964 00529641 1/2   AD(P)-binding domain                    
   2::122      1.8 24.4% 0047278 00472781 1/2   )-binding Rossmann-fold domains         
   2::107      4.3 25.0% 0046344 00463441 1/2   AD(P)-binding domain                    
 207::246      4.4 27.5% 0047564 00475642 2/2   AD(P)-binding domain                    
   2::134      4.6 23.6% 0045481 00454811 1/2    N-terminal domain                      
 220::246       17 40.7% 0048583 00485832 2/2   AD(P)-binding domain                    
   1::33        22 38.7% 0036785 00367851 1/2   )-binding Rossmann-fold domains         
   2::114       47 30.0% 0042342 00423421 1/2   )-binding Rossmann-fold domains         
   1::443


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGKRMVVVGGVAGGASAAAKAKRENPELEVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRK
00374411   1/1  MpvligllesliidtalllgllpplsaskkydvvviGaGpaGlaaAleLara..GlkVtvlEardrlGGr
00435771   1/1  M.kdVaviGAGiaGlaaAyeLara..GlkVtvlEardrlG.Grsrtvgypgfrldlgaglipgsypylle
00491501   1/1  MirvcpalceslvvlaaglepplpplsaskkkdvvviGaGpaGlaaAyrLaraGl..kVtvlEardrlG.
00481992   2/2  ----------------------------------------------------------------------
00470681   1/2  lllllmmmlhydvvviGgGpAGlaaAlrlarldpgarvlliekepglgynrgclpkklllaaaelldlll
00400491   1/1  MkdleyDvvvvGaGpaGlaaAlalaragpdlkvaliekgp.lgggasclngggipakllledllerlvvd
00470221   1/1  m.yDVvviGgGiaGlaaAlrLara..GlkVlvlEagdrlGGrlrtvrlgggtsldlggivfpgl..ypal
00503631   1/1  masmsmkydvvIiGaGpaGlaaAlrLar..aGlkvtvlEkgprlG.gtwrtgrypglllllpallyllld
00458701   1/1  --ydVvvvGAGiaGlaaAlrLaea..GltdvlvlEagdrvGGrartvrypgfrfdlgahvflgpgg....
00462741   1/1  mlMkkkyDviiiGaGpaGlaaAleLara..GlkVlvlEkgdrlGGtwasngipgipsdggaavilgpell
00360921   1/1  pplmmdeeydvvViGaGpaGlaaAlrLara..GlkVlvlErgGrlasgripgklldggahllpglleell
00467501   1/2  kkkdvvvvGgGpaGltaAlrlarlgpdlevtliekgdrlgg.tpllpgvlggkllae..lllrllelllk
00400351   1/1  MeyDvvvvGaGpaGlaaAlrLara..GlkVlvlErgdrpGGtsltnggpgfkldlgaalllg......pe
00363002   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00520321   1/1  MmdeeyDvviiGaGpaGlsaAlrLara..GlkVlvlEkgpllggtsglngggihaglskllldlrdllee
00359891   1/1  MkeldeeyDvviiGaGpaGlsaAlrLaraG...kVlvlEkgpvlggtsglngggipggllld........
00485831   1/2  lsedkeyDVvviGgGpaGlaaAlalaraG..lkVlllEkgpelggtclaaggipskallllalgllllel
00483642   2/2  ----------------------------------------------------------------------
00499901   1/1  -kkdvvviGAGiaGlaaAlrLaea..GhkVtvlEardriGGrsrtnggllipglrldlgahlfpgsyell
00488662   2/2  ----------------------------------------------------------------------
00470291   1/1  lllllslsllllllsslllmmskeyDvviiGaGpaGlvaAlrLae.laGlkVlvlEaGGtarnggyigsk
00526001   1/1  MseeyDvvvvGaGpaGltaAleLaraG..lkVlllEagdrvg.Gtslrngglphkg..lreladrliell
00465142   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00406601   1/1  ----MddlpeeyDVvViGaGlaGlaaAaaLara..GlrVlvlEkrdrlG.GtsatsrypGfrfdvggsll
00380742   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00475641   1/2  lldkeyDVvviGgGpaGlaaAlrlara..GlkvlllEkgdrlgGtclnsgcipskalllaalglllllga
00467602   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00480161   1/1  tgkkVavvGaGpAGlaaAaqLaraldlseelghdvtvferlprpgg...llrygiapdfrlpkevvdrlv
00413411   1/1  ----MpmsseeyDvvViGaGpaGlaaAlrlara..GlkVlllEkgpvlg.Gtssrn..qggirldlgaip
00473271   1/1  M.yDviviGaGiaGlaaAyrLaka..GlkVlvlEkgdrlGGraatfrldgfrvdnvgahpfkgl...npe
00461561   1/1  -gkkvaviGaGpaGlaaAllLakalpghdvtvfEkgp...vpggllrygiapdfrlpkelldrliellee
00484942   2/2  ----------------------------------------------------------------------
00483561   1/1  MskkydvviiGaGiaGlsaAlrLara..GlkVlllEkgdrlGGtsgrnaglipgglrldaall.......
00363012   2/2  ----------------------------------------------------------------------
00533212   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00461281   1/1  glellllslltemmskeyDvvvvGaGpaGlvaAlrLae.daGlkVlvlEagdrlgGascipsgaglgadl
00533222   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00440982   2/2  ----------------------------------------------------------------------
00487712   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00413941   1/1  ----------------------------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00490032   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00529262   2/2  ----------------------------------------------------------------------
00406022   2/2  ----------------------------------------------------------------------
00462702   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00396642   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00458812   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00444131   1/1  ----MsdedyDviviGaGiaGlvaAarLakaG..lkVlvlEkgdrlGGtaatlgldglkfdlggsvihgl
00360162   2/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00488651   1/2  mlpkdvviiGgGpaGleaalalarlglklevtliergdrlggtllplgpgpllglldaeelaeylrelle
00496792   2/2  ----------------------------------------------------------------------
00468342   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00509272   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00483641   1/2  --ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcllskalgllglldeelalrllellek
00457971   1/2  sekydvviiGaGpaGlaaAlrlarl.aglkvlliekg.rlgglllllayggil.lrvgfiplkrlaelle
00486072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00486071   1/2  ----myDvviiGaGpaGlaaAlrLara..GlkVlvlEk.drlGGtclnvgcipskallyagllpdelell
00492221   1/2  MmktpvliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLara.pGlkVlvlEkgdrl
00465792   2/2  ----------------------------------------------------------------------
00476822   2/2  ----------------------------------------------------------------------
00363001   1/2  mekydvvviGaGlaGlsaAlelaragl..dvtvlergprlgg..cllllsvpggrldpeelvlalaelle
00464463   3/3  ----------------------------------------------------------------------
00529631   1/2  mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrttgrigsgldlgpsllrlleelgl
00509601   1/2  --kdvvviGgGpaGleaAlalar...glkvtliergdrlggtrpllsgvipgkll.deelaeylrellek
00368901   1/1  ----------------------------------------------------------------------
00472701   1/2  ledllldllsmstkkdvvviGaGpaGleaAlalarl..glkvtlierglGgtllnggpglskplll.rvl
00384682   2/2  ----------------------------------------------------------------------
00440981   1/2  MeskkydvvviGaGpaGlaaAlylaragl..kvtllekgprlggllntgcgpsklllpgallgaelveal
00457952   2/2  ----------------------------------------------------------------------
00364591   1/2  mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGlaaAlalar
00492222   2/2  ----------------------------------------------------------------------
00509271   1/2  --vydvviiGaGpaGlaaAlrlaraglklsevlllek.drl.ggtilllggvpsglllgaalllallell
00523131   1/2  msydVvvvGAGiaGlsaAlaLarr..Glrvlllergdvlggascrnsggglakgllleelpalggvdrar
00418871   1/1  ----------------------------------------------------------------------
00523132   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00395041   1/1  ----------------------------------------------------------------------
00503641   1/2  -epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelakag..levtvfertpri
00471411   1/2  mstkkdvaiiGaGpaGlsaAiyLaraGld.dvtvlEkndrlgGrll....ggipgfalpaelldalaela
00376431   1/2  -eydvvvvGaGpaGlaaAlalara..glkvlllekgprlggllvglipskllllrvlgaelaaalaeale
00529111   1/2  ----llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAGpaGLsaA
00410231   1/1  ----------------------------------------------------------------------
00368891   1/2  ppipglellltsddalellelpkdvvviGgGpaGleaAlalarl..glkvtliergdrlgglld......
00471412   2/2  ----------------------------------------------------------------------
00488661   1/2  srprvlpipgldlegvlllrtlldsdallellalpkdvvviGgGpaGleaAaalarlga..kvtlvergd
00463571   1/1  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00468341   1/2  --smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprpggrsrggglypgglellrelg
00480091   1/2  ppipglegvltsrdlldllelpkdvvviGgGpaGleaAlalarl..gaevtvvergdrlgglld......
00533221   1/2  ipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl..gaevtvvergdrlgglld......
00380741   1/2  keydvvviGgGpaGlaaAlrlara..Glkvlllekgdlgggclnvgcipgkrllaaaelydelrelleel
00484941   1/2  --aakkydvvIiGaGpaGlaaAlrLara..GlkVtvlEkgdrlG.Grsrtggypgfpiidsgallfpell
00488071   1/2  irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalara..Glk
00454812   2/2  ----------------------------------------------------------------------
00501481   1/2  lmeleydvvviGgGpaGlaaAlylara..glkvtliekgplllyalgglllyvgcilskallllgilgee
00455191   1/2  ppipgvellltsddalalkelpkdvvviGgGpaGleaAlalarl..gakvtlierrdrll.gtl......
00529261   1/2  lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlAaraGpdlkVtvlEkg
00366551   1/1  ----------------------------------------------------------------------
00424461   1/2  vPrvlpipgidlggvlhaldfldpkalkgkkVaviGaGpaGlaaAlyLarlGa..evtvierrprlggtl
00485841   1/2  rPrvppipgldlvltsddlldleelpkdvvviGgGviGleaAlalarlg..akvtvvergdrll.gtld.
00455331   1/1  ----------------------------------------------------------------------
00480451   1/2  pgldlelvltsddlldleelpkdvvviGgGpaGleaAlalarl..gakvtlverrdrlgglld.......
00533831   1/1  ----------------------------------------------------------------------
00479091   1/2  -mmsylplfldlkgkrVliiGgGpaGltaAlelakaGa..kvtlverdpr...................p
00482001   1/2  llpipglevltsdgaldllelpkdvvviGgGpaGleaAlalarlgl..kvtlvergdrlg.gtl......
00384491   1/2  lpgvellltsddalaleelpkdvvviGgGpaGleaAlalarlgl..kvtvverdrlggtldcilskall.
00503642   2/2  ----------------------------------------------------------------------
00455181   1/2  MseydvvviGgGpaGlaaAlrlaea..GlkvlvlEkgdrlgglsnrngipglrlllgalllrllelleel
00475651   1/2  pipgldlegvltsrdlldllelpkdvvviGgGpaGleaAlalarl..gakvtvvereprlg.gtld....
00406041   1/1  ----------------------------------------------------------------------
00406881   1/2  MsskeydvvviGgGpaGlaaAlrlara..Glkvlllekgdrlgglllagcipgkallaaalllrllella
00445591   1/1  ----------------------------------------------------------------------
00477121   1/2  ektdVaIvGAGpaGlaaAlaLara..GldvtvlErrdrpggtalgrggalsprglelleelglldallar
00467611   1/2  --gvlllltsddalalkelpkdvvviGgGyiGleaAlalarllpegakvtlvergdrllpcld.......
00529112   2/2  ----------------------------------------------------------------------
00472711   1/2  PrlpdipglelflgkgvhtsatldgllfkgkdvvviGgGpaGleaAlalarlgl..kvtllerrprlggt
00465141   1/2  eieydvvViGaGpaGlaaAlrlara..GlkVtviEkgprlggclnvgcipgkaldaaalllrllelleel
00366541   1/2  vlpipgldgegvltsrdlldllelpkdvvviGgGpaGleaAaalarl..gakvtvvergdrlg.gtld..
00483651   1/2  -ipgldlpgvlllltsddalallellllakpkdvvviGgGpaGleaAlalarlGa..kVtviergdrlgg
00481081   1/2  aalliliaslglellpadylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaalarllpelgaeVtlv
00469721   1/2  dlpgvellltsddalalkelpkdvvviGgGpaGleaAlalarlga..kvtliergdrllglldpelskal
00496791   1/2  PgipgleeflgkgvhtsatldglefrgkdvvviGgGpaGleaAlylarlgl..kvtlierrdrlggd...
00469731   1/2  --dipglellltsddalalkelpkdvvviGgGyiGleaAaalarl..gaevtlvergdrllpyldcelsk
00457981   1/2  lpkrlvviGgGyiGlelAsalrrlgpdaaevtlvergdrll...pyldpelsklll..........elle
00509611   1/2  lPrllpipglegvlllrtlldsdlllellelpkdvvviGgGpaGleaAlalarlgl..kVtliergdrlg
00464161   1/2  MleydvvviGgGpaGlaaAlrlara..GlkvlliekgdrlGGtllntgcipgkalllgalllellrelle
00457951   1/2  --yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlG.Gtsglnaglippglggplddrglal
00465791   1/2  mkeyDvvIiGaGiaGlsaAlrLaka..GlkVlvlEkgdrpGgrgasgrnaggiapglgyddrllalakes
00529642   2/2  ----------------------------------------------------------------------
00363011   1/2  ppipgldlegvftlrtlddalalreallagkrvvvvGgGlaGleaAaalrrlglevtlvergdrlllpyl
00472761   1/1  ----------------------------------------------------------------------
00419401   1/2  --lPdipglelvltsddalelkepkkvvviGgGyiGleaAsalrrl..gaevtliergdrllpll.....
00471331   1/2  tmkydvviiGaGpaGlaaAlrlara..GlkvlllEkgprlgyktllalGgllltvglipgkallgaalll
00533211   1/2  mekydvviiGaGpaGlaaAlrlara..GlkvlvlEkgprpgglsrlnggggaaldlpsklllrlldllle
00406901   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00458811   1/2  -----llydvvIiGaGpaGlsaAlrLara..GlkVlvlEkGplvnrdrlGGtsnggdgrldlgahvffll
00472782   2/2  ----------------------------------------------------------------------
00509281   1/1  ----------------------------------------------------------------------
00487711   1/2  -kydvviiGaGiaGlsaAleLarrGlk.dVtvlErgplpggggasgrnagllhaglaylelarlaresld
00396641   1/2  ----MsylasaallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkValvEkgdlgggasgr
00406021   1/2  MseyDvvvvGaGpaGlaaAlrlara..GlkvlllEkgdrlggtsllgggllnagdildklgllaallvrl
00486871   1/1  ----------------------------------------------------------------------
00464461   1/3  MmplslllatalelplpalaldkkyDvvViGaGpaGlaaAlalara..GlkVlllEkgdrlG.Gtsltag
00375101   1/1  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------------------
00490031   1/2  lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalara..GlkVlllEkgprlggtsclnggglppg
00447051   1/2  arprllpipgedlflgkgvltsatilgalllfkgkdvvviGgGpaGleaAlylarlga..kvtlierrdr
00462701   1/2  MMsplllalllllpllllaldeeydvvviGaGpaGlaaAlalara..GlkVlllEkgdrlGGtslrsggi
00476821   1/2  lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae...GlkVlvlEaggrlg.grgat
00382851   1/2  lpkrvvviGgGliGlelAaalrellpklg..levtlveagdrl......lpryldpelsklll......e
00467601   1/2  MkeyDvvviGaGpaGlaaAlrlarlgld.kvlviekgpllggqtllllggtclnvgcipskllllaallp
00425341   1/1  ----------------------------------------------------------------------
00406191   1/2  -gkrVvviGaGpaGldaArellkdldlllktdisdnaleallarlga..evtvvgRrgpliaaftlkele
00423422   2/2  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00460571   1/2  pmmskkkdvvViGaGiaGlsaAlaLara..GysVtvlErgdrpggtsgtnggllaaglvapllllpggip
00464462   2/3  ----------------------------------------------------------------------
00455201   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00384681   1/2  -gkdVaViGaGpaGldaAlylarlgak.kvtlverrdrlg.................fpafpelvellke
00351301   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00384501   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00481991   1/2  klllatgslplipplegllldgvlllrtlldalallemlkkeydvvviGgGpaGlaaAaylarl..Glkv
00387841   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00475211   1/1  ----------------------------------------------------------------------
00374371   1/2  -agrlavleaalllervltglgalagllpgkrvlViGa..GgiGleaAaalarlGa..kVtvvd......
00470682   2/2  ----------------------------------------------------------------------
00360161   1/2  -gkrVvviGgGpaGldaArlllksldellktdindlalealkrlggkeVtvveRrgpleapftlkelrel
00467502   2/2  ----------------------------------------------------------------------
00529641   1/2  -gkrVvViGaGaSgldialelakv..aksvtllersdelggpw...........................
00472781   1/2  -ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdide...............
00463441   1/2  -gkrVlVvdgGgGpaGleaAealarrGhe..Vtlvealdrlggl...lrlgipdpller..........l
00475642   2/2  ----------------------------------------------------------------------
00454811   1/2  -gkrVvViGaGlsGlaaarlllrlG..aevtvldrrdrpggl........................llle
00485832   2/2  ----------------------------------------------------------------------
00367851   1/2  kgkkvlviGa.GgiGralaraLaeaGa.evtva-------------------------------------
00423421   1/2  -ldllplfldlrgkdvlviGgGdvGlaaarllleaga..kvtvve.......................rr


                         -         -         *         -         -         -         -:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
00374411   1/1  lrtaripglgasldlggilfpgl..sprllellaelgleaelarllglrvlilldgtvvsldgdld....
00435771   1/1  lleelglelairlntevggavllpdgglltvprdladllaellaladgllleadavilAtGarprlppip
00491501   1/1  Grsrtaglippgflldlgahvfpg..laplllelleelglelelltlagaavlalldgklidlpadvarl
00481992   2/2  -------------------------------------klllatgslplipplegllldgvlllrtlldal
00470681   1/2  elaglgllllvaagdldaeelvlalaelleelgvevllgtrvtgidpdgvtvtladge.....titadkl
00400491   1/1  llkggailvdedlvelldge...............aleadalllatGarpr.lgipgsdlpgvllalg..
00470221   1/1  lelleelglelallaldgellayldglvlelgidlntlvvaldpdalevlledlee.....lradavvlA
00503631   1/1  lpllfglpppggggvdraelldylleaaerlgvedvirlgtevtsidfdedgvvvgvtted...G..eti
00458701   1/1  .....elleylldlleelgleddlrlntevggarlllpdgkllvltsdlnalllelradalilatgalpr
00462741   1/1  ellrelgielgpkvpeildyllklldkfdllklleflskvngveyiegrasfldagkwevltedgwgife
00360921   1/1  aglgdlaellalkpelvalledgaailllprgvrllaglglggssainagvylrvspadfdelgawgvtl
00467501   1/2  lgvevllg.evtsidpdgktvtledg.....etleydllvlAtGarprllpipgldlegvltlrtlldal
00400351   1/1  lleelgteaaellaergvrvlrgkg................lgggstinadavvlatgadprllgipgld
00363002   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00382852   2/2  --------------------------------------------srPrvlpipgldlegvlllrtledal
00520321   1/1  lgvelllggaglvdprgvellgelg...............leadalllatG.rpfdlpipglelfgvrgl
00359891   1/1  .dllerlg........edlliglallvdgdlvvvltgeg...leadalllatGapprlldipgldelggl
00485831   1/2  aallgillllllldlllllrrllllllllaagvegllillgvevvvgvadgggvtvv...tgdgetirad
00483642   2/2  ----------------------------------------------------------------------
00499901   1/1  ldlleel.......gvelrlntrvv.vdrdgklvtvpl..dldgleleadavvlatGalsllprlpdipg
00488662   2/2  --------------------------------------------srprvlpipgldlegvlllrtlldsd
00470291   1/1  pdlgaalfgelldelyelgle.....ldgrrllfprgkvlGGsssinggvylrgskndfdlwaglagleg
00526001   1/1  eelgvelllntvvgalltlaellaeydavvlalglglatglagrglavprgrvlggssvingavylrada
00465142   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00406601   1/1  pgtipgllrllrelgledlellplglagvirgggsvvnalpdeaeallaelgvlfpigyaellpfyerle
00380742   2/2  ----------------------------------------------------------------------
00463442   2/2  --------------------------------------vviatgsapvvitqlpipgadlarvltleevl
00364592   2/2  ----------------------------------------------------------------------
00475641   1/2  alfglllllllllldlvllgaakralgaellrllaelaeklgveillgtavtellkddggvvv....tgd
00467602   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00480161   1/1  dlledlgvefvlnvev............gvdvtldellleydavvlAtGatkprllgipgldldgvysal
00413411   1/1  ldlleelgldl.......................vkggdgltleagalvlatgarpripplpglgvpgvl
00473271   1/1  lldllkelg..ledkldlrrlvllrgkvlggpsdlngllavr...gdedlleakalllatg..pylpllp
00461561   1/1  lgveirlntev..........gkdvtledll..leydavvlAtGalsprllgipgedlpgvvlaldflll
00484942   2/2  ----------------------------------------------------------------------
00483561   1/1  ..............................lvrlalesldalreliatgarplglpipgrdlgglllard
00363012   2/2  -------------------------------------------------ppipgldlegvftlrtlddal
00533212   2/2  ----------------------------------------------------------------------
00475652   2/2  --------------------------------------------------pipgldlegvltsrdlldll
00485842   2/2  ---------------------------------------------rPrvppipgld..lvltsddlldle
00455182   2/2  -----------------------------------------------------------------Ms...
00483652   2/2  ---------------------------------------------------ipgldlpgvlllltsddal
00461281   1/1  gltllpglfdtllagldgrdllarrgkvlggsslingmvylrglpedldelakllgvegwgydellpyfk
00533222   2/2  ---------------------------------------------------ipgldlegvltsrdlldll
00406882   2/2  -----------------------------------------------------------------Ms...
00480092   2/2  -------------------------------------------------ppipgle..gvltsrdlldll
00479092   2/2  ----------------------------------------------------------------------
00509612   2/2  ---------------------------------------------lPrllpipgle..gvlllrtlldsd
00366542   2/2  ------------------------------------------------vlpipgldgegvltsrdlldll
00424462   2/2  ---------------------------------------------vPrvlpipgidlggvlhaldfldp.
00457972   2/2  ----------------------------------------------------------------------
00455192   2/2  ------------------------------------------------------ppipgvellltsddal
00464162   2/2  ----------------------------------------------------------------------
00368892   2/2  -------------------------------------------------ppipgle.....llltsddal
00440982   2/2  ----------------------------------------------------------------------
00487712   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------prvlpipGedlcgvlslrdfvgdy
00480452   2/2  ----------------------------------------------------pgldlelvltsddlldle
00413941   1/1  ----------------------------------------------------------------------
00482002   2/2  ------------------------------------------------llpipgle...vltsdgald..
00457982   2/2  ---------------------------------------------------iPgle..lvltsddaldle
00419402   2/2  ------------------------------------------------lPdipgle.....lvltsddal
00490032   2/2  ----------------------------------------------------------------------
00481082   2/2  ------------------------------------------------------aalliliaslglellp
00469722   2/2  -------------------------------------------------------dlpgvellltsddal
00384492   2/2  --------------------------------------------------------lpgvellltsddal
00529262   2/2  ----------------------------------------------------------------------
00406022   2/2  ----------------------------------------------------------------------
00462702   2/2  -----------------------------------------------------------------MMspl
00447052   2/2  --------------------------------------------arprllpipgedlflgkgvltsatil
00396642   2/2  -----------------------------------------------------------------Msyla
00469732   2/2  --------------------------------------------------dipgle.....llltsddal
00458812   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------Prlpdipglelflgkgvhtsatld
00444131   1/1  lypallrllrklgldlgpkilhalgelvdlllrtdvsdylefrlldgrvvfpdgkvlkvptnlaellksf
00360162   2/2  ----------------------------------------------prklgiPGedlpgvfsardfvawy
00477122   2/2  ----------------------------------------------------------------------
00488651   1/2  klgvevllgtevtsidgdgkgvtledg.....etleadlvvlatGarpntppipgldllgvldvr-----
00496792   2/2  -------------------------------------------------Pgipglee...flgkgvhtsa
00468342   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------gvlllltsddal
00509272   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00483641   1/2  lgvelllgtevtsidlegktvtllllvlgdgetleydklvlAtGarp-----------------------
00457971   1/2  allelaeklgveillgtevtdidlddd..vvvvltdgetitltadavvlAtGsrprllpipgldlegv--
00486072   2/2  ----------------------------------------------------------------------
00374372   2/2  --------------------------------------------------agrlavleaalllervltgl
00486071   1/2  eelglpllpgldipvlpgrkgggreellrylaealeklgveirlgtalfvdpnrVts.....vtvttedG
00492221   1/2  G.GtsrnggvipdgglldpelldlleelGlpfdlllpgggvvdpaellralaealaeelgveirl-----
00465792   2/2  ----------------------------------------------------------------------
00476822   2/2  ----------------------------------------------------------------------
00363001   1/2  elgvevrlgtevtsidrdgdgvtledge.....tleadavvlAtGarprvlllpgl--------------
00464463   3/3  ----------------------------------------------------------------------
00529631   1/2  ldelleeglsplypglrldvpkelygfpdfplpgwfpvfpgrkelldyladlaeklgveirlnteV----
00509601   1/2  lgvevllgtevtsidgdgkgvtlddg.....e.leadavvlatGsrpntpllpglelderggilvdetlr
00368901   1/1  ----------------------------------------------------------------------
00472701   1/2  gpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtledg.....etleadavvlAtGa------
00384682   2/2  --------------------------------------------ftprvlpipgeeacglltadepvail
00440981   1/2  lelleelgveillgtevtsidldgggvvltdge.....tieadavvlAtGarprllglpgl---------
00457952   2/2  ----------------------------------------------------------------------
00364591   1/2  aGl..kvtllekgdrlggrlllvggipggv..lpeelvealaelleklgveirlgtrvt..dg..vgvtt
00492222   2/2  -----------------------------------------------------------------Mmktp
00509271   1/2  eklgveillgtevtsidld..ggtvvgvttgdgetltad..vlAtGarprllllllvpgipgfdgkgv--
00523131   1/2  laaalaeaaealgveirlgtevtdllleggrvtgVr.tadGe..tlradavvlAtGafsrlllllglelp
00418871   1/1  ----------------------------------------------------------------------
00523132   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00395041   1/1  ----------------------------------------------------------------------
00503641   1/2  gglwrgipypp.....lgkelldyleeyarklglrirfgtevtsvdrdgwtv......tgeeltle----
00471411   1/2  eklgveirlgtev.....dgvtvttedg.....etieadavvlAtGalrprllpipgldlpgvlg-----
00376431   1/2  elgvevllgtevtsidrdgggvtgvllvttgdgetiradavvlAtGarpntplleglglelderggiv--
00529111   1/2  yyLakarPglkVlvlEkgdrpGGasgrnggilpsglltdellelleelgipfdpegpgggtvdgaalvra
00410231   1/1  ----------------------------------------------------------------------
00368891   1/2  .......pelaaallelleklgvevllgtevtaidvdgdgvt----------------------------
00471412   2/2  ----------------------------------------------------------------------
00488661   1/2  rlggtlld............eelaaallelleklgvevllgtrv--------------------------
00463571   1/1  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00468341   1/2  ledeleelgvdflkalvvlldldlvlalrllgpdvtggerrpragvvdraellralleaaeelGngrvei
00480091   1/2  .......eelsllllelleklgvelllgtrvtaidvdgdgvtvt--------------------------
00533221   1/2  .......eelslallelleklgvelllgtrvtaidvdgdgvtvt--------------------------
00380741   1/2  gipfdevllglllllgrggadgaelaaalaelleelgvevllgtavt.i..ddg----------------
00484941   1/2  pyllellkelglelrlpdlggrvvvlpdgkvlgydlglgalpdspealgleefpg---------------
00488071   1/2  VtllEardrlggrlllsggipgk..vdpaellealaelaeelgveirlgtrv....--------------
00454812   2/2  ----------------------------------------------------------------------
00501481   1/2  llarlreqleklgveillgtrvtsidldggtvvltdg.....etieadavilAtGvlvaigrrpntell-
00455191   1/2  ......dpelskallelleklgvevllgtevteidg.............dgetl----------------
00529261   1/2  drlGGtsrt.nggliprgleelldelgipgalldagfpydgllfvfgggfigledargllrlgagvtvvd
00366551   1/1  ----------------------------------------------------------------------
00424461   1/2  lalgripakllglealllrllllllglglllpipgrvlpkellea-------------------------
00485841   1/2  ...........pelsklllelleklgvdlllgtkvtaidrdgdgv-------------------------
00455331   1/1  ----------------------------------------------------------------------
00480451   1/2  ......pelaaallelleklgvelllgtrvtaidldgggvtvtl--------------------------
00533831   1/1  ------------------------------------------------------------lellgvalle
00479091   1/2  elallllelleklgvevllgtrvteiakeylpelllgveveagdgvvtvv.lgdgetieadlvilAt---
00482001   1/2  ......dpelsklllelleklgvevllgtevtaiegdgdgvvvv--------------------------
00384491   1/2  .............elleelgvevllgtevteveldgggvvvvlg--------------------------
00503642   2/2  ----------------------------------------------------------------------
00455181   1/2  gipfdlpglgglflprggrvdgaelaaalaeaaeelgveillgtrvt.i..dggvvgvtt..--------
00475651   1/2  ........pelskallelleklgvelllgtevtaidgdgdgv----------------------------
00406041   1/1  ----------------------------------------------------------------------
00406881   1/2  elgiellllpypgvdlslvplllrvlgaelaaalaealeelgveillgtav-------------------
00445591   1/1  ----------------------------------------------------------------------
00477121   1/2  gvpldglvvvdgggrlaldfaelalgapg.yvvdraellralleaaeel...gv----------------
00467611   1/2  .......pelsklllelleklgvdvllgtevtaidvddktvtvvt-------------------------
00529112   2/2  ----------------------------------------------------------------------
00472711   1/2  l..................dlllelleklgveillgtevteidg--------------------------
00465141   1/2  gvelrlppldglllpgvgdvlgaelaaalaealeelgveillgtrvteidggvvgvttedg.--------
00366541   1/2  ..........pelskallelleklgvevllgtevtaidvdgdg---------------------------
00483651   1/2  rlld............eelalallelleklgvelllgtevtei---------------------------
00481081   1/2  ergdrl..........lpglld..eelaelllelleklgvelllgt------------------------
00469721   1/2  l..............elleklgvelllgtevtaidldgdgvtvv--------------------------
00496791   1/2  ............pelleyllelleklgveillgtevteiegdgd--------------------------
00469731   1/2  all..............elleklgvdlllgtkvtaidrdddgvl--------------------------
00457981   1/2  klgvevllgtkvtsidrgedgvvvvtledget..leadlvllA---------------------------
00509611   1/2  g.ld.............pelskallelleklgvelllgtevteid-------------------------
00464161   1/2  lgglflllpdldlelllelldalveelaaalaealeelgveillgtevt.ie------------------
00457951   1/2  aeetlellrelgaelglldglvrpngalvlaigledadelarlgkrvavlgggellladgvtgglrpdgg
00465791   1/2  lellkelgaelgidlfrppgklvvagggdiglllelaealrrlgvpvellspeelkell-----------
00529642   2/2  ---------------------------------------------ePripdipglleefkgkvlhsaayr
00363011   1/2  rpelskal..............lelleelgvelrlgtevtsidr--------------------------
00472761   1/1  ----------------------------------------------------------------------
00419401   1/2  ........deelsllleelleelgidvllgtevteiekdgdg----------------------------
00471331   1/2  elaelleelgvevtllellggdrvlprldldgpellkallealeklgv.illg-----------------
00533211   1/2  laellarlgaevlrlllglltllergdrllp.ellrallealeelgveirlgt.vtei------------
00406901   1/1  ----------------------------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00458811   1/2  lppgllellaelglplglelldlleelleelgidfllgkgvgglsaingvvlerg---------------
00472782   2/2  ----------------------------------------------------------------------
00509281   1/1  ----------------------------------------------------------------------
00487711   1/2  llrelveelgidfrrygklvlatgeaelellrelaealralgvdvel-----------------------
00396641   1/2  sgggiaaglrllienylgldlaellvedlvkggaglvdedlveilatga---------------------
00406021   1/2  .....................................adalvlatgarprrlgipglelpggr-------
00486871   1/1  ----------------------------------------------------------------------
00464461   1/3  gilldlgarlleglglldlleelleelgielrllrdgklvvaltgegle---------------------
00375101   1/1  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------------------
00490031   1/2  glrylaglglldlleelaeelgidldflrdgllvlaldgegleadalll---------------------
00447051   1/2  lggtl..................dlllelleklgveillgtev---------------------------
00462701   1/2  lldgglrlleglglldrleelleelgieldllvdgrlvvaladealead---------------------
00476821   1/2  psgggflvdtgadwlfgtepelglegrgillprgkvlGGsslinggvlv---------------------
00382851   1/2  lleelgvelllgtkvtsiegdgdgvvvtle.dgetle..adlv---------------------------
00467601   1/2  ellelleglgvefdleekgvdldglrlaydklvdaelaaalaelleklgvevllgt.v------------
00425341   1/1  ----------------------------------------------------------------------
00406191   1/2  rlpelggllrygipedkllkeflareiadlplrrlleellaylle-------------------------
00423422   2/2  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00460571   1/2  llalalealdllrelglelgidf.......rvgalvlatglaela.....dalllal-------------
00464462   2/3  -----------------------------------------------------------------Mmpls
00455201   1/1  ----------------------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00384681   1/2  egveillgtavleilgddgkvtgvrvvrveldesgrvvvvtgeg--------------------------
00351301   1/1  ----------------------------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00531721   1/1  ------------------------------------------------------------rrsrllllig
00384501   1/1  ----------------------------------------------------------------------
00484141   1/1  -------------------------------------------------------------dyiglvnll
00481991   1/2  lliekgprlggtclnvgcipskallkaaelael-------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00475211   1/1  ----------------------------------------------------------------------
00374371   1/2  ...................rrpellerleelgakfvlltldeelvevv----------------------
00470682   2/2  ----------------------------------------------------------------------
00360161   1/2  ggllrygippdpldlallelelellpraldrlvellldlllelp--------------------------
00467502   2/2  ----------------------------------------------------------------------
00529641   1/2  ...........lgvvillnteveevtgdgvvledgtelleaD----------------------------
00472781   1/2  ..ekleglalelidillpklv..................dvvvttelkevlk------------------
00463441   1/2  eelgveillgvavteilgdgvel.......geelele---------------------------------
00475642   2/2  ----------------------------------------------------------------------
00454811   1/2  lgvefvlgs..................lllellleadlvvlspgvpldhpllelarelgievig------
00485832   2/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00423421   1/2  llprlaalaeelgvevvlgdfleedl..................--------------------------


                         +         -         -         -         -         *         -:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
00374411   1/1  fevlladgeeleadalilatGarprllpipgfdgkgvltardlldll......flgkrvvviGggvsgle
00435771   1/1  gldlkgvltsrdll........dllgkrvvviGgGasgldiaealarlgaevtvverrprllalldalal
00491501   1/1  laarlvrlldgleleadalilatGarprlllpipgldlfgv.lgrvllssdlllgllllgkrvvviGgga
00481992   2/2  allemlkkeydvvviGgGpaGlaaAaylarlGlkvlliekgprlggtclnvgcipskallkaaelaelie
00470681   1/2  vlAtGarprllpipgldlpgvlvlrtlddalalrellaallpkrvvvvGgGliGlel-------------
00400491   1/1  ............krvvvvgggviglelaaal............................aealealpgve
00470221   1/1  tGsrprlppipgedlggvlhsallldll........gkrvvvigggasgldlaellarlgaevtvvlerr
00503631   1/1  eadavvlAtGalsrprlppsipgldltfkggvtlsavws.dgalallgllvdllpkrvvviGgG.sglel
00458701   1/1  lppipgldlgevlhsagyeellrrlgldllgkrvvvigggasavela.alaragasvtlllrsprlgllt
00462741   1/1  eeltadaviiatGarpripdlipgl.gggvltsddyldled.....lpgklvdfvllalalaiaviGgga
00360921   1/1  ddlepyfelaadalvlatGsrprlpplpglelggv.....lltaaealgldflgkrvvvigggasgvela
00467501   1/2  alrealldlllllkgkrvvvvGgGliGlelaaalaelglevtlveradrl--------------------
00400351   1/1  ydfllpgvhsaedalg......ldllgkrvvviGggysgvelaealarlgapvtlldrsplarlppglls
00363002   2/2  ------mekydvvviGaGlaGlsaAlelaragldvtvlergprlggcllllsvpggrldpeelvlalael
00472702   2/2  -----ledllldllsmstkkdvvviGaGpaGleaAlalarlglkvtlierglGgtllnggpglskplllr
00488652   2/2  -------mlpkdvviiGgGpaGleaalalarlglklevtliergdrlggtllplgpgpllglldaeelae
00382852   2/2  ellellelpkrvvviGgGliGlelAaalrellpklglevtlveagdrllpryldpelsklllelleelgv
00520321   1/1  ltlldalkleplllssdlaggllypgkrvvvigggaille..............................
00359891   1/1  lsldal...........ggrvvvigggviglelaral............................leaae
00485831   1/2  avilAtGarsrvppipgldlpgvltsrtaldllfl......gkrvvviGgGyiglelAlalarlgak---
00483642   2/2  ---------ydvviiGgGpaGltaaiylarlgpdlkvtliekggtclyvgcllskalgllglldeelalr
00499901   1/1  ldlfsleellsalglldll.....gkrvvvigggasgvdlaellarlgarvtllerldglllpgdgvldp
00488662   2/2  allellalpkdvvviGgGpaGleaAaalarlgakvtlvergdrlggtlldeelaaallelleklgvevll
00470291   1/1  wsydellpyfkkaekliiatgsrpllpdlpgglllggdgiltselalsl...dllpklvvvigggaigle
00526001   1/1  idfatgar....gipgwdldgvlpyfdrledslgvlglpflgkrvvviGggpigvefaealarlgakvtl
00465142   2/2  ------eieydvvViGaGpaGlaaAlrlaraGlkVtviEkgprlggclnvgcipgkaldaaalllrllel
00509602   2/2  ---------kdvvviGgGpaGleaAlalar.glkvtliergdrlggtrpllsgvipgklldeelaeylre
00501482   2/2  ----lmeleydvvviGgGpaGlaaAlylaraglkvtliekgplllyalgglllyvgcilskallllgilg
00376432   2/2  --------eydvvvvGaGpaGlaaAlalaraglkvlllekgprlggllvglipskllllrvlgaelaaal
00406601   1/1  klygvlgegylpdlpgasifkglpvhssfddreldldgkrvvvigsga...savrakavviatGareral
00380742   2/2  -------keydvvviGgGpaGlaaAlrlaraGlkvlllekgdlgggclnvgcipgkrllaaaelydelre
00463442   2/2  lgkakt.....gkrVlVvdgGgGpaGleaAealarrGheVtlvealdrlggllrlgipdpllerleelgv
00364592   2/2  -------mgrvcppcegaclllllagpvailllepaladelllgllplllpamskkkdvvvvGaGpaGla
00475641   1/2  getiradavilAtGarsrvppipgldgpgvltsdtalell......llpkrvvviGggyiglelal----
00467602   2/2  ----------MkeyDvvviGaGpaGlaaAlrlarlgldkvlviekgpllggqtllllggtclnvgcipsk
00471332   2/2  -------tmkydvviiGaGpaGlaaAlrlaraGlkvlllEkgprlgyktllalGgllltvglipgkallg
00480161   1/1  dflfgynllldglyllgllargkrvvviGggntaldvartllrlgasvtlverrgrll....apaspkel
00413411   1/1  tsdgalalrep......gkrvvviggglsglel..................lvgrgdgaalaralaeaae
00473271   1/1  glsleevl........dsllgldllpklvlvigggviglelaellarlgaevtvlergdgllgggdgqiy
00461561   1/1  gnllpg....krvvviGgalrlldgvigntaldvartlarlgakvtlverrglllpatpeelra.....l
00484942   2/2  ---------aakkydvvIiGaGpaGlaaAlrLaraGlkVtvlEkgdrlGGrsrtggypgfpiidsgallf
00483561   1/1  aldldalpkrlavl......gggllgvdelaellpllgsevtgglrsprggtvdparlvralaeaaeelG
00363012   2/2  alreallagkrvvvvGgGlaGleaAaalrrlglevtlvergdrlllpylrpelskallelleelgvelrl
00533212   2/2  ------mekydvviiGaGpaGlaaAlrlaraGlkvlvlEkgprpgglsrlnggggaaldlpsklllrlld
00475652   2/2  el......pkdvvviGgGpaGleaAlalarlgakvtvvereprlggtldpelskallelleklgvelllg
00485842   2/2  el......pkdvvviGgGviGleaAlalarlgakvtvvergdrllgtldpelsklllelleklgvdlllg
00455182   2/2  ........eydvvviGgGpaGlaaAlrlaeaGlkvlvlEkgdrlgglsnrngipglrlllgalllrllel
00483652   2/2  allellllakpkdvvviGgGpaGleaAlalarlGakVtviergdrlggrlldeelalallelleklgvel
00461281   1/1  vaedglgltadaiiiatgsrprypgipg........plsvswaldl...delpkrlvvigggaiglelap
00533222   2/2  el......pkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglldeelslallelleklgvelllg
00406882   2/2  ......skeydvvviGgGpaGlaaAlrlaraGlkvlllekgdrlgglllagcipgkallaaalllrllel
00480092   2/2  el......pkdvvviGgGpaGleaAlalarlgaevtvvergdrlgglldeelsllllelleklgvelllg
00479092   2/2  ---------mmsylplfldlkgkrVliiGgGpaGltaAlelakaGakvtlverdpr......pelallll
00509612   2/2  lllellelpkdvvviGgGpaGleaAlalarlglkVtliergdrlgg.ldpelskallelleklgvelllg
00366542   2/2  el......pkdvvviGgGpaGleaAaalarlgakvtvvergdrlggtldpelskallelleklgvevllg
00424462   2/2  ....kalkgkkVaviGaGpaGlaaAlyLarlGaevtvierrprlggtllalgripakllglealllrlll
00457972   2/2  ------sekydvviiGaGpaGlaaAlrlarlaglkvlliekg.rlgglllllayggillrvgfiplkrla
00455192   2/2  alkel...pkdvvviGgGpaGleaAlalarlgakvtlierrdrllgtldpelskallelleklgvevllg
00464162   2/2  -----M.leydvvviGgGpaGlaaAlrlaraGlkvlliekgdrlGGtllntgcipgkalllgalllellr
00368892   2/2  ell...elpkdvvviGgGpaGleaAlalarlglkvtliergdrlgglldpelaaallelleklgvevllg
00440982   2/2  -----MeskkydvvviGaGpaGlaaAlylaraglkvtllekgprlggllntgcgpsklllpgallgaelv
00487712   2/2  ----------kydvviiGaGiaGlsaAleLarrGlkdVtvlErgplpggggasgrnagllhaglaylela
00406192   2/2  nlhpaawllppdltgkrVvviGaGpaGldaArellkdldlllktdisdnaleallarlgaevtvvgRrgp
00480452   2/2  el......pkdvvviGgGpaGleaAlalarlgakvtlverrdrlgglldpelaaallelleklgvelllg
00413941   1/1  ----------------------------------------------------------------------
00482002   2/2  ....llelpkdvvviGgGpaGleaAlalarlglkvtlvergdrlggtldpelsklllelleklgvevllg
00457982   2/2  el......pkrlvviGgGyiGlelAsalrrlgpdaaevtlvergdrllpyldpelsklllelleklgvev
00419402   2/2  elke....pkkvvviGgGyiGleaAsalrrlgaevtliergdrllplldeelsllleelleelgidvllg
00490032   2/2  ------lMlpeslleplpalsaseeydVvViGaGpaGlaaAlalaraGlkVlllEkgprlggtsclnggg
00481082   2/2  adylvlaigssdgaldlpklpkrvvvvGgGyiGlelAaalarllpelgaeVtlvergdrllpglldeela
00469722   2/2  alkel...pkdvvviGgGpaGleaAlalarlgakvtliergdrllglldpelskallelleklgvelllg
00384492   2/2  aleel...pkdvvviGgGpaGleaAlalarlglkvtvver.drlggtldcilskallelleelgvevllg
00529262   2/2  ---------lniksielflsiieraldeglvppsmemmmekydvvIiGaGpaGlaaAlrLlqlAaraGpd
00406022   2/2  ------MseyDvvvvGaGpaGlaaAlrlaraGlkvlllEkgdrlggtsllgggllnagdildklgllaal
00462702   2/2  llalllllpllllaldeeydvvviGaGpaGlaaAlalaraGlkVlllEkgdrlGGtslrsggilldgglr
00447052   2/2  ga....lllfkgkdvvviGgGpaGleaAlylarlgakvtlierrdrlggtld.....lllelleklgvei
00396642   2/2  saallaalpslletieyDVlviGgGpaGlsaAlelarlapdaGlkValvEkgdlgggasgrsgggiaagl
00469732   2/2  alkelp...kdvvviGgGyiGleaAaalarlgaevtlvergdrllpyldcelskallelleklgvdlllg
00458812   2/2  -----------llydvvIiGaGpaGlsaAlrLaraGlkVlvlEkGplvnrdrlGGtsnggdgrldlgahv
00472712   2/2  g...llfkgkdvvviGgGpaGleaAlalarlglkvtllerrprlggtl.....dlllelleklgveillg
00444131   1/1  llglsekrrllaflgviatgdrpralgipgldldd...lslfellerfllldllpklllilgggliglep
00360162   2/2  nglpdaallepdltgkrVvviGgGpaGldaArlllksldellktdindlalealkrlggkeVtvveRrgp
00477122   2/2  -------ektdVaIvGAGpaGlaaAlaLaraGldvtvlErrdrpggtalgrggalsprglelleelglld
00488651   1/2  ----------------------------------------------------------------------
00496792   2/2  tldglefrgkdvvviGgGpaGleaAlylarlglkvtlierrdrlg..gdpelleyllelleklgveillg
00468342   2/2  ---------smasesdydvvIiGaGpaGlsaAlrLaralgklpGlkVtvlEkgprpggrsrggglypggl
00467612   2/2  alkelp...kdvvviGgGyiGleaAlalarllpegakvtlvergdrllpcldpelsklllelleklgvdv
00509272   2/2  --------vydvviiGaGpaGlaaAlrlaraglklsevlllek.drlggtilllggvpsglllgaallla
00460572   2/2  ------pmmskkkdvvViGaGiaGlsaAlaLaraGysVtvlErgdrpggtsgtnggllaaglvapllllp
00483641   1/2  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00486072   2/2  ----------myDvviiGaGpaGlaaAlrLaraGlkVlvlEk.drlGGtclnvgcipskallyagllpde
00374372   2/2  galagllpgkrvlViGaGgiGleaAaalarlGakVtvvdrrpellerleelgakfvlltldeelvevvla
00486071   1/2  etg-------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00465792   2/2  ----------mkeyDvvIiGaGiaGlsaAlrLakaGlkVlvlEkgdrpGgrgasgrnaggiapglgyddr
00476822   2/2  -----------lallslllllllglllalpdlamdkeyDvvvvGaGpaGltaAlrLae.GlkVlvlEagg
00363001   1/2  ----------------------------------------------------------------------
00464463   3/3  --------------------------------------------------elaralaeaaeelgveillg
00529631   1/2  ----------------------------------------------------------------------
00509601   1/2  tsvp------------------------------------------------------------------
00368901   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00384682   2/2  flerlihsyavkdgppftgkdVaViGaGpaGldaAlylarlgakkvtlverrdrlgfpafp....elvel
00440981   1/2  ----------------------------------------------------------------------
00457952   2/2  ---------yDVvIiGaGpaGlsaAlrLaraGldlgselkVtvlEkgdrlGGtsglnaglippglggpld
00364591   1/2  edg.------------------------------------------------------------------
00492222   2/2  vliklleslladtalrlpplpplsldeeyDVvvvGAGpaGlaaAyeLarapGlkVlvlEkgdrlGGtsrn
00509271   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00418871   1/1  ----------------------------------------------------------------------
00523132   2/2  -------msydVvvvGAGiaGlsaAlaLarrGlrvlllergdvlggascrnsggglakgllleelpalgg
00504431   1/1  -----lmeikkvaviGaGlmGlgiAavlaraGleVvlvdinpealeraldeiaklllklvlkgllvelll
00529632   2/2  -----mptkkdVaiIGAGpaGLaaAllLaraGhdldVtvfErrdrpGGlwrttgrigsgldlgpsllrll
00395041   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00471411   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00529111   1/2  la--------------------------------------------------------------------
00410231   1/1  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00471412   2/2  -----mstkkdvaiiGaGpaGlsaAiyLaraGlddvtvlEkndrlgGrllggipgfalpaelldalaela
00488661   1/2  ----------------------------------------------------------------------
00463571   1/1  ---------mKiaviGaGyvGlelAavla.lgheVtlvdinpeklea........lnegllp.ilelgld
00488072   2/2  ------irvcilcelacllllllgpvlilllelaaalllpllllpatkkkdvaviGaGpaGlaaAlalar
00468341   1/2  rlgtrvtsi-------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00484941   1/2  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00454812   2/2  ----tdlkgkrVvViGaGlsGlaaarlllrlGaevtvldrrdrpggl...........lllelgvefvlg
00501481   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00529261   1/2  rgdllrala-------------------------------------------------------------
00366551   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00533831   1/1  vlgkrilkgkkvaviGaGgvGlalAllllelgvaaeVtlvDiddelleglalelgdiisllgk.......
00479091   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00503642   2/2  ---------epklPdipGledFkgelfhsarwphdlvdltgkrVaviGaGpaGlaaaaelakaglevtvf
00455181   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------------------------------------
00406881   1/2  ----------------------------------------------------------------------
00445591   1/1  --------pkkvaviGaGgvGlalAlllaaagggdVtlvDidpekleglaadlldilelllve.......
00477121   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529112   2/2  -----------llsnlplgrllpfllptslwldtlplpllellisraileralpdldmdkeyDVvIvGAG
00472711   1/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00457951   1/2  r---------------------------------------------------------------------
00465791   1/2  ----------------------------------------------------------------------
00529642   2/2  dpedf...kgkrVvViGaGaSgldialelakvaksvtllersdelggpw..............lgvvill
00363011   1/2  ----------------------------------------------------------------------
00472761   1/1  ---------ysrplllgligllgakvlpgkkvaviGaGgvGlalAlalaaagaagevtlvDideeklegl
00419401   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00533211   1/2  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------------------------------------
00479921   1/1  --------pkkvaviGaGavGlalAlalaraGaageVvlvdrd........eerlealaadledllellg
00458811   1/2  ----------------------------------------------------------------------
00472782   2/2  ---------ldifvkrlikelivvklpgkkvvviGaGpvGlalAlalallgavgkVvlvdideeklegla
00509281   1/1  ----------------------------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00396641   1/2  ----------------------------------------------------------------------
00406021   1/2  ----------------------------------------------------------------------
00486871   1/1  -llllllkikkvafiGlGgmGmsalAllllkaGyeVtgsDlnd...........pallelleelgievvl
00464461   1/3  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------------------
00490031   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00462701   1/2  ----------------------------------------------------------------------
00476821   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00425341   1/1  --lsmvlkgkkvaviGaGliGlalalllallglgeVvlyDinpekleglaadladilelllvk.......
00406191   1/2  ----------------------------------------------------------------------
00423422   2/2  ------ldllplfldlrgkdvlviGgGdvGlaaarllleagakvtvve..........rrllprlaalae
00482271   1/1  ---------mkiaviGaGyvGlplAallaeaGheVvgvDideekvealndgilpilepgleellrdllda
00460571   1/2  ----------------------------------------------------------------------
00464462   2/3  lllatalelplpalaldkkyDvvViGaGpaGlaaAlalaraGlk--------------------------
00455201   1/1  ----------------------------------------------------------------------
00452431   1/1  ---------tisvaelalalllalarnlpgaapllragiwrasdllglelkgktvgviGlGriGlalarl
00384681   1/2  ----------------------------------------------------------------------
00351301   1/1  ----------------------------------------------------------------------
00466731   1/1  -----mlkikkvaViGaGlmGsgiAavlaaaGikVvlvDidpealekalkrilklleklvklgllsaaea
00423401   1/1  ---------aGylavllaalllcrflgglgllltlagglagkkvlviGaGgvGlaaarllaalGakVtvl
00481021   1/1  ---------lllmlkmmkiaviGaGavGtalAallaengheVtlwdr........neekvellnekgenp
00531721   1/1  legqeklkgakVaviGaGgvGlalAllLalagvagevvlvDidevklsnlardllh..............
00384501   1/1  ----------------------------------------------------------------------
00484141   1/1  kklgldlkgktvliiGaGgvGlaiaqalaalGakkVvlvdrd........eekaqalveqlkelgs....
00481991   1/2  ----------------------------------------------------------------------
00387841   1/1  ---------kkvlvtGAsGgiGsalalllakegaevvlvdr........deekalealagelldlgg...
00481861   1/1  ---------kkvlvtGAsGgiGsalalllaargaevvl--------------------------------
00367852   2/2  -------kgkkvlviGaGgiGralaraLaeaGaevtva--------------------------------
00355351   1/1  --------GkkvaviGlGsmGlalAallaaaGheVlvwdrdpekveelaelgapvakylpglell.....
00480351   1/1  ---------gllldtallvllllllllldlkgkvalVtGasggiGlaiAralaaaGarVvladrneekle
00366641   1/1  ---------ntesvaelalalllalarrlpeaaagvrtgkwlllggllgrelagktvgviGlGniGlava
00528371   1/1  --------mkkvgiiGlGlmGlslalalaraGfadeVvgydr........npeklekalelgat......
00475211   1/1  --------ikkihfiGiGgsGmsalAllllklGykVtgsDlk...........lsplterleelgievfl
00374371   1/2  ----------------------------------------------------------------------
00470682   2/2  ---------------------------------------------------------elleelgvevllg
00360161   1/2  ----------------------------------------------------------------------
00467502   2/2  --------------------------------------------------elllrllelllklgvevllg
00529641   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475642   2/2  ------------------------------------------------------------------illg
00454811   1/2  ----------------------------------------------------------------------
00485832   2/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
00374411   1/1  laealarllkilgaevtllersdrllallddegqvdprglldalaealeellgveirlgtrvteierdgg
00435771   1/1  llgllsldalaalepllalellggllypdggpaalvealaeal.e.gveillgtrvteierdgggvt.vt
00491501   1/1  iglelalalarlgaevtlversprlgpvlpaglsealaealeallGveirlgtrvteierdgggvt.vtt
00481992   2/2  llpglgvelllgglgldlaellerkdavvdgeelaaalaelleelgvevllgtav..iiddgtvtv...d
00470681   1/2  ----------------------------------------------------------------------
00400491   1/1  illgtevtellgdggrvtgvvledgetgeevtiradavvlatGgrpnlellltnppgntgdglallerag
00470221   1/1  drlllffppdgqvdpaglvralaealeallgveirlgtrvteierdgggvt.VttadGetieadlvvlat
00503631   1/1  asalarlgakvtlverrprllprldpelvepllealeklgvevllnlkvteiegc---------------
00458701   1/1  prggygalvealakalendylealarlgveirlgtrvteilrdgggvt.vttadGetieadavvlatgar
00462741   1/1  sglelasalarlgakvtllersgrllppgglgelvkallelleklGveirlntevteierddgkvtgvtt
00360921   1/1  salarlgagvtvvyrpdgg....rgalaralaraaeaagvtvltgtrvteierdggggrvtgVtledgeg
00467501   1/2  ----------------------------------------------------------------------
00400351   1/1  pgdglldggdgalvaalaealerlgveillgtrvteilrdgggvtgVttedgeleldgeevtiradavvl
00363002   2/2  leelgvevrlgtevtsidrdgdg..vtledgetleadavvlAtGarprvlllpglellegagleld..gg
00472702   2/2  vlgpelaeylrelleklgveillgtrvtsidrdgdtgrvtgvtledgetleadavvlAtGarsnpnilgl
00488652   2/2  ylrelleklgvevllgtevtsidgdgkg..vtledgetleadlvvlatGarpntppipgldllgvldvrg
00382852   2/2  elllgtkvtsiegdgdgvvvtledgetlead---------------------------------------
00520321   1/1  .alaeaaeelGveiltgtevteierdggrvtgVtvrdtadGeeetiradlvvlatGarsnvrllglsglg
00359891   1/1  elpgveillgtevteilgdgdgvtvttgrvtgvvlrdladGeevtiradlvvlatGarsnllllllsgig
00485831   1/2  ----------------------------------------------------------------------
00483642   2/2  llelleklgvelllgtevtsidlegktvtllllvlgdgetleydklvlAtGarpvvvaigvtpntgllk.
00499901   1/1  kgglgallealleelgveillgtpvtei.............Geleadavvlatgldplael...lglelp
00488662   2/2  gtrvtaidvdgdgvtvtlvtlgdgetleadlv--------------------------------------
00470291   1/1  lapvlarlgakvtgvgrlprglpvgdgglsalvaalakalerlgveiltntrvtrilvdggggglrvtgV
00526001   1/1  vergglllpgdgvgdraslaralleaaealgveiltgtrvteilrdedggrvtgVetrdladGeeftira
00465142   2/2  leelgvelrlppldglllpgvgdvlgaelaaalaealeelgveillgtrvtei.d.ggvvgvttedgeti
00509602   2/2  lleklgvevllgtevtsidgdgkg..vtlddgeleadavvlatGsrpntpllp..glelderggilvdet
00501482   2/2  eellarlreqleklgveillgtrvtsidl.dggtvvltdgetieadavilAtGvlvaigrrpntellkl.
00376432   2/2  aealeelgvevllgtevtsidrdgggvtgvllvttgdgetiradavvlAtGarpntplleglglelderg
00406601   1/1  papgldllgrspagalpllsrrflvdllpklllaggglvnlllasdstrylefkalpkslviigggvigv
00380742   2/2  lleelgipfdevllglllllgrggadgaelaaalaelleelgvevllgtavt.i.ddgrVtl...dgeti
00463442   2/2  eillgvavteilgdgvel...geeleleaDlvvlatgftpndel................dealrtsvpg
00364592   2/2  aAlalaraGlkvtllekgdrlggrlllvggipggvlpeelvealaelleklgveirlgtrvt.....dg.
00475641   1/2  ----------------------------------------------------------------------
00467602   2/2  llllaallpellelleglgvefdleekgvdldglrlaydklvdaelaaalaelleklgvevllgt.vtei
00471332   2/2  aalllelaelleelgvevtllellggdrvlprldldgpellkallealeklgv.illgt.veilgddggv
00480161   1/1  relleegveflfladpveidgdgrvvgvelvdg-------------------------------------
00413411   1/1  algveiltgtevteilrdeggrvtgVvtadtkdGeevtiradavvlatGafsnlrlllglglgltgdgla
00473271   1/1  prggagallealak.gveirlntevtrie..........dGetieadaVilaaGaipsprllglsgiglk
00461561   1/1  leegvelllltspveilgdgrvvgvvlvdgeek-------------------------------------
00484942   2/2  pellpyllellkelglelrlpdlggrvvvlpdgkvlgydlglgalpdspealgleefpgrvvvigggyig
00483561   1/1  veillgtevtsierdggvvgVttedGeiradlvvlAtGawsp.ellkllgielplgllpvrgqilvv...
00363012   2/2  gtevtsidrdg...vvlddgttleadllvlAt--------------------------------------
00533212   2/2  lllelaellarlgaevlrlllglltllergdrllpellrallealeelgveirlgt.vtei..dggvvgv
00475652   2/2  tevtaidgdgdgvvvvlllvdvvlgdgetl----------------------------------------
00485842   2/2  tkvtaidrdgdgvtvvlllkdgdgetleadlvl-------------------------------------
00455182   2/2  leelgipfdlpglgglflprggrvdgaelaaalaeaaeelgveillgtrvt.i..dggvvgvttdgetir
00483652   2/2  llgtevteidgdgggvvvltdgetleadlvv---------------------------------------
00461281   1/1  flarlgakvtgvgrlpgll.plggvdpsalvaalakalerlgveiltntrvtrilrdgggkglrvtgvev
00533222   2/2  trvtaidvdgdgvtvtledggeeetleadlvv--------------------------------------
00406882   2/2  laelgiellllpypgvdlslvplllrvlgaelaaalaealeelgveillgtavve.dg.grvtl...dge
00480092   2/2  trvtaidvdgdgvtvtledggeeetleadlvv--------------------------------------
00479092   2/2  elleklgvevllgtrvteiakeylpelllgveveagdgvvtvvlgdgetieadlvilAtGarpnnlll--
00509612   2/2  tevteidgd....vvlgdgetleadlvvlAtGar------------------------------------
00366542   2/2  tevtaidvdgdgvtvtvldvvlgdgetlead---------------------------------------
00424462   2/2  lllglglllpipgrvlpkellealaealeklgve------------------------------------
00457972   2/2  elleallelaeklgveillgtevtdidldddvvvvltdgetitltadavvlAtGsrprllpipgldlegv
00455192   2/2  tevteidg.........dgetleadavliAtGarpntlllgl......enggivvde-------------
00464162   2/2  ellelgglflllpdldlelllelldalve.elaaalaealeelgveillgtevt.i.edgrv.gvtledg
00368892   2/2  tevtaidvdgdgvtvtllldgdgetleadl----------------------------------------
00440982   2/2  eallelleelgveillgtevtsidldgggv.vltdgetieadavvlAtGarprllglpgldlpgglealg
00487712   2/2  rlaresldllrelveelgidfrrygklvlatgeaelellrelaealralgvdvelldaaelraleplldl
00406192   2/2  liaaftlkelerlpelggllrygipedkllke--------------------------------------
00480452   2/2  trvtaidldgggvtvtledgetleadlvvlAt--------------------------------------
00413941   1/1  ----------------------------------------------------------------------
00482002   2/2  tevtaiegdgdgvvvvvklvtlgdgetleadl--------------------------------------
00457982   2/2  llgtkvtsidrgedgvvvvtledgetleadl---------------------------------------
00419402   2/2  tevteiekdgdgvlvvvvlgdgetleadlv----------------------------------------
00490032   2/2  lppgglrylaglglldlleelaeelgidldflrdgllvlaldgegleadalllatGapprlldipgldll
00481082   2/2  elllelleklgvelllgtkvteidgdgkgvtvt-------------------------------------
00469722   2/2  tevtaidldgdgvtvvtledgetleadlvllA--------------------------------------
00384492   2/2  tevteveldgggvvvvlgltvevvvlgdgetl--------------------------------------
00529262   2/2  lkVtvlEkgdrlGGtsrtnggliprgleelldelgipgalldagfpydgllfvfgggfigledargllrl
00406022   2/2  lvrladalvlatgarprrlgipglelpggrvvvigggvialeeaaeelgveiltgtevteidg...vvgv
00462702   2/2  lleglglldrleelleelgieldllvdgrlvvaladealeadalllatGarprllpipgldllgglvvvi
00447052   2/2  llgtevteiegdgdgftvtlvrllnlvdgdg---------------------------------------
00396642   2/2  rllienylgldlaellvedlvkggaglvdedlveilatgappavleleglgvpflrtsdgaldlkgglva
00469732   2/2  tkvtaidrdddgvlvvvledgetleadlvllA--------------------------------------
00458812   2/2  fflllppgllellaelglplglelldlleelleelgidfllgkgvgglsaingvvlergsaedydalipa
00472712   2/2  tevteidgdgggvtgvtledgldgeeetlead--------------------------------------
00444131   1/1  aelsarlglkvt.vlflggllyfgdsaqlyprgGlgal--------------------------------
00360162   2/2  leapftlkelrelggllrygippdpldlalle--------------------------------------
00477122   2/2  allargvpldglvvvdgggrlaldfaelalgapgyvvdraellralleaaeelgveirlgtrvtsileed
00488651   1/2  ----------------------------------------------------------------------
00496792   2/2  tevteiegdgdgvtgvtledgeltgeeetlea--------------------------------------
00468342   2/2  ellrelgledeleelgvdflkalvvlldldlvlalrllgpdvtggerrpragvvdraellralleaaeel
00467612   2/2  llgtevtaidvddktvtvvtledgetleadlvl-------------------------------------
00509272   2/2  ll.elleklgveillgtevtsidldggtvvgvttgdgetltad..vlAtGarprllllllvpgipgfdgk
00460572   2/2  ggipllalalealdllrelglelgidfrvgalvlatglaeladalllalgapprlldapelrellpvvvp
00483641   1/2  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00486072   2/2  lelleelglpllpgldipvlpgrkgggreellrylaealeklgveirlgtalfvdpnrVts.......vt
00374372   2/2  ltvdvsdeegrlkavetleellgeaDvvivaagippataplllteellelmkpggiivdiasvaggivet
00486071   1/2  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00465792   2/2  llalakeslellkelgaelgidlfrppgklvvagggdiglllelaealrrlgvpvellspeelkellpll
00476822   2/2  rlggrgatpsgggflvdtgadwlfgtepelglegrgillprgkvlGGsslinggvlvrglpedfdalglg
00363001   1/2  ----------------------------------------------------------------------
00464463   3/3  trvteilvdeggrvtgvttedadGeeltiradavvlatGgfpnlalllglglpphPdgrllfgprdddel
00529631   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00368901   1/1  ----------------------------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00384682   2/2  lkeegveillgtavleilgddgkvtgvrvvrv--------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00457952   2/2  drglalaeetlellrelgaelglldglvrpngalvlaigledadelarlgkrvavlgggellladgvtgg
00364591   1/2  ----------------------------------------------------------------------
00492222   2/2  ggvipdgglldpelldlleelGlpfdlllpgggvvd----------------------------------
00509271   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00418871   1/1  ----------------------------------------------------------------------
00523132   2/2  vdrarlaaalaeaaealgveirlgtevtdllleggrvtgVrtadGetlradavvlAtG------------
00504431   1/1  gaal......aritgttdlealadadlVieavpenldvklavlaeleallkpgailas....ntsslsit
00529632   2/2  eelglldelleeglsplypglrldvpkelygfpdfplpgwfpvfpgrkelldyladlaeklgveirlnte
00395041   1/1  ----------------------------------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00471411   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00410231   1/1  ----------------------------------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00471412   2/2  eklgveirlgtev......dgvt.vttedgetieadavvlAtGalrprllpipgldlpgvlgvhsllsav
00488661   1/2  ----------------------------------------------------------------------
00463571   1/1  elveell..gnltattdleealkdaDlviiavgtplkdgdgrpdldivnavaeeiakll.gpdtivvss-
00488072   2/2  aGlkVtllEardrlggrlllsggipgkvdpaelleal---------------------------------
00468341   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00484941   1/2  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00454812   2/2  s..............lllellleadlvvlspgvpldhpllela---------------------------
00501481   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00366551   1/1  ----------------------------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00533831   1/1  ...........alkvdtddeealldaDlvilatgaplkpg..............qevldlletnlkivya
00479091   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00503642   2/2  ertprigglwrgipypplgkelldyleeyarklglri---------------------------------
00455181   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------------------------------------
00406881   1/2  ----------------------------------------------------------------------
00445591   1/1  ..........rlitttdleealadaDvviiavgtprkpgm------------------------------
00477121   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529112   2/2  paGLsaAyyLakarPglkVlvlEkgdrpGGasgrnggilpsglltdellelleelgipfdpegpgggtvd
00472711   1/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00465791   1/2  ----------------------------------------------------------------------
00529642   2/2  nteveevtgdg....vvledgtelleaDav----------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00472761   1/1  ardlldilellgv..................g--------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00533211   1/2  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------------------------------------
00479921   1/1  vdlra..........ttdleealkdaDlviiavg------------------------------------
00458811   1/2  ----------------------------------------------------------------------
00472782   2/2  lelidillpklv..................dvvvttelkevlkgaDvvilatga..............pr
00509281   1/1  ----------------------------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00396641   1/2  ----------------------------------------------------------------------
00406021   1/2  ----------------------------------------------------------------------
00486871   1/1  ghdaella...............dadlvvvslaipldnpell----------------------------
00464461   1/3  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------------------------------------
00380761   1/1  ----------------------------------------------------------------------
00490031   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00462701   1/2  ----------------------------------------------------------------------
00476821   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00425341   1/1  ..........grirattdlyealkgaDvviiavgvprkp-------------------------------
00406191   1/2  ----------------------------------------------------------------------
00423422   2/2  elgvevvlgdfleedlgd..............adlviaatgdpevnel----------------------
00482271   1/1  .........grltattdlaealadadvviiavgtpld---------------------------------
00460571   1/2  ----------------------------------------------------------------------
00464462   2/3  ----------------------------------------------------------------------
00455201   1/1  ----------------------------------------------------------------------
00452431   1/1  laalGakVivydrspekleeldglgvdsleellke..................-----------------
00384681   1/2  ----------------------------------------------------------------------
00351301   1/1  ----------------------------------------------------------------------
00466731   1/1  llllleallgritattdladaladadlvie----------------------------------------
00423401   1/1  drnpekleqleelgadav...................---------------------------------
00481021   1/1  iylpglelp.......enltattdleeavkdadlviiavptdalrsvlrqlakllkdvllkkgaiivslt
00531721   1/1  ....iladlgvpkvvvanleealadaDvviia--------------------------------------
00384501   1/1  ----------------------------------------------------------------------
00484141   1/1  kikvkavsldvgdveeleellg..kvDivinaaglgepakl-----------------------------
00481991   1/2  ----------------------------------------------------------------------
00387841   1/1  .galvlvadvtdleavedlvealggadvvvnnagvp..............rkpgeerldllevnvlgtkn
00481861   1/1  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00355351   1/1  ...........grlrattdleealadaDvvilavpt.pavrsvlaelapllkpgaivvdlstglvgtiea
00480351   1/1  alaaelgalg..ralavaadvtdpesvealv..............ggldilvnnagilgall......gp
00366641   1/1  rrlaalGakVivydrspraleelgadvv.sleellae.................----------------
00528371   1/1  ...........dliaatdlaealkdaDvvilavptpavrevle---------------------------
00475211   1/1  ghdaenll...............dadlvvvspaipldnpelva---------------------------
00374371   1/2  ----------------------------------------------------------------------
00470682   2/2  trvtgi.dpdgvtvtladgetitadklvlAtGarprl---------------------------------
00360161   1/2  ----------------------------------------------------------------------
00467502   2/2  .evtsidpdg..ktvtledgetleydllvlAtGarpr---------------------------------
00529641   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475642   2/2  tavtellkddggvvvtgdgetiradavilAtGarsr----------------------------------
00454811   1/2  ----------------------------------------------------------------------
00485832   2/2  ---------ggvtvvtgdgetiradavilAtGarsr----------------------------------
00367851   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           DVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
00374411   1/1  gvt.vtledgdgeeetieadlvvlatGarsltellglpp-------------------------------
00435771   1/1  tedadgslkpvledgetieadavvlatGarslarllldpp------------------------------
00491501   1/1  edGdgeeetieadavvlatGarpllrlledlglpeplrp-------------------------------
00481992   2/2  getieadlvilAtGarprlpplpggrrpntelleaaglel------------------------------
00470681   1/2  ----------------------------------------------------------------------
00400491   1/1  lelhdtrggivvdetlrtsvpglyaaGdvagtplhgag.rlggnglataaasGrlaaeaaagylag----
00470221   1/1  GarsllrllglpglgleldpagerlpdgWgggipvdpdlrtgvpglylaGdaaggfgg........ggva
00503631   1/1  ----------------------------------------------------------------------
00458701   1/1  plaellgllgpelpergiiavdglpvgsllkvhlgfdepf------------------------------
00462741   1/1  dGeeieadlv------------------------------------------------------------
00360921   1/1  ltgeevtiradlvvlaaGarsttrllllsglglplppd--------------------------------
00467501   1/2  ----------------------------------------------------------------------
00400351   1/1  atGarssprllllsgigpaellkalgielpldlpgv----------------------------------
00363002   2/2  ivvdeylrtsvpgvyaaGdvagvplpllglgggggl----------------------------------
00472702   2/2  egagl.lderggivvdetlrtsvpgvfaaGdvaggp.......---------------------------
00488652   2/2  aivvdellqtgkpvvvaggdvagleglllgllllle----------------------------------
00382852   2/2  ----------------------------------------------------------------------
00520321   1/1  lpgdgyalairvgeplpdhlpggivvdetlrtsvpglyaaGdaaggsghgan.....plggnglataias
00359891   1/1  ptgdglalleraglelvderggivvdeglrtsvpgl----------------------------------
00485831   1/2  ----------------------------------------------------------------------
00483642   2/2  aglelderggivvdetlrtsvpgiyAaGDvagvpglllgl------------------------------
00499901   1/1  erglivvdpglrtgvpglylaGdaagpggp.........g------------------------------
00488662   2/2  ----------------------------------------------------------------------
00470291   1/1  etedgggeektiradkeVilaaGaigsprllllsgigl--------------------------------
00526001   1/1  dlV-------------------------------------------------------------------
00465142   2/2  eadavvlAtGarslllllgrrpntellglegaglelderg------------------------------
00509602   2/2  lrtsvpgvfaagDvagkpv..........lvvgagaegrl------------------------------
00501482   2/2  glelderggivvdelllrtsvpgvfaaGdvaggplr...-------------------------------
00376432   2/2  givvdetlrtsvpglyaaGdaa.........ggvnplag-------------------------------
00406601   1/1  patraeifsskllslaekr---------------------------------------------------
00380742   2/2  tadavilAtGarprllglpgitptllleaagvelderggi------------------------------
00463442   2/2  vfa-------------------------------------------------------------------
00364592   2/2  vgvttedgetiea---------------------------------------------------------
00475641   1/2  ----------------------------------------------------------------------
00467602   2/2  egddgrvtgvvvvrledgetleadlvilatGglslllllg------------------------------
00471332   2/2  .gvtledGeeetieadlvvlAtGglsrvrlllvrpntellgl----------------------------
00480161   1/1  ----------------------------------------------------------------------
00413411   1/1  lalrlgaplpdggflqfhPthytmggivvdpdlrtsvp--------------------------------
00473271   1/1  ldklg.igvvekvrlsvdgpfaggdladhlqlv.....--------------------------------
00461561   1/1  ----------------------------------------------------------------------
00484942   2/2  lelagkrvrvggakvtllqrrppfvlpllllgllll----------------------------------
00483561   1/1  ...-------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00533212   2/2  tledGeeetleadlvvlatGsvvrlllgvrpnlegllleg------------------------------
00475652   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00455182   2/2  adavilAtGalslplllglspntpgllleglgieldergg------------------------------
00483652   2/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406882   2/2  tieadlvvlAtGarsllllgrrpntellllelagleld.r------------------------------
00480092   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00457972   2/2  ltsptsildalalllellpgklvviggGaivllaigrrp-------------------------------
00455192   2/2  ----------------------------------------------------------------------
00464162   2/2  eeltleadlvilatGrrslPlllpntellgleklgv----------------------------------
00368892   2/2  ----------------------------------------------------------------------
00440982   2/2  lelderggivvdetlrtsvpglyaaGdvaggpgp.....-------------------------------
00487712   2/2  pdllgglyvpdggvvdpaalaaalaraaealGveirlgtevtgierdggrvtgVrtadGeieadlvvlAa
00406192   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00413941   1/1  -----------------------------------------gylgipavvftdpelAsvGlteeeAkelg
00482002   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00490032   2/2  ggrvvvigggvdglelaralaeaaeelgveillgtrvte-------------------------------
00481082   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00529262   2/2  gagvtvvdrgd.llralaeaaeelGveirlgteVtsier-------------------------------
00406022   2/2  vledGeeltieadlvvlatGarsnlrlllgldlpkelleg------------------------------
00462702   2/2  gggviglelaralaeaaeelgveillgtrvteilvdegg-------------------------------
00447052   2/2  ----------------------------------------------------------------------
00396642   2/2  vigggsiarelalaeaalklgveilegtevtellg-----------------------------------
00469732   2/2  ----------------------------------------------------------------------
00458812   2/2  tga-------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00477122   2/2  gdgvtvtledggeeetieadlvvgAdGarsr..vr-----------------------------------
00488651   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00468342   2/2  Gngrveirlgtrvtsierdgelledleeypvtvtl-----------------------------------
00467612   2/2  ----------------------------------------------------------------------
00509272   2/2  gvhtartlldldllgkrvvviGggaiglelaligvrpntegl----------------------------
00460572   2/2  gggvvdpaallealaeaaeelGveirlg.rvtsi......------------------------------
00483641   1/2  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00486072   2/2  vtted-----------------------------------------------------------------
00374372   2/2  sv--------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00465792   2/2  dfp-------------------------------------------------------------------
00476822   2/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00464463   3/3  lrllpglgvaliarytaggipvdpdgrpllgrltsvp---------------------------------
00529631   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00368901   1/1  --------------------------------------------gvpsvvftdpeiAsvGlteeeakelg
00472701   1/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00457952   2/2  lrpdggrvdparlvrallealeelGveillg.evtei---------------------------------
00364591   1/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00509271   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00418871   1/1  ------------------------------------------yraipsvvftdpeiAsvGlteeeakeag
00523132   2/2  ----------------------------------------------------------------------
00504431   1/1  aladalgrpgrviglhf-----------------------------------------------------
00529632   2/2  VtsverdgdgvtvttedgepdgeeetleadaVvlAtGalsrprllgllpdipgldl.fggrvlhsalyld
00395041   1/1  ------------------------------------------ydaipsvvftdpeiAsvGlteeeakeag
00503641   1/2  ----------------------------------------------------------------------
00471411   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00410231   1/1  ------------------------------------------ydaipsvvftdpeiAsvGlteeeAkeag
00368891   1/2  ----------------------------------------------------------------------
00471412   2/2  llgllllgkrvvvig-------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00468341   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00484941   1/2  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00366551   1/1  ----------------------------------------ydaiPsvvf..tdpeiAsvGlteeeakeag
00424461   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00455331   1/1  ----------------------------------------ydaiPsvvf..tdpeiAsvGlteeeakeag
00480451   1/2  ----------------------------------------------------------------------
00533831   1/1  vgee------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00503642   2/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00406041   1/1  ----------------------------------------ydaiPsvvf..tdPeiAsvGlteeeakeag
00406881   1/2  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529112   2/2  gaalvralaeaaleelg-----------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00465791   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00533211   1/2  ----------------------------------------------------------------------
00406901   1/1  ----------------------------------------ydavPsvvf..tdPeiAsvGlteeeakeag
00479921   1/1  ----------------------------------------------------------------------
00458811   1/2  ----------------------------------------------------------------------
00472782   2/2  lpgalrld--------------------------------------------------------------
00509281   1/1  ----------------------------------------ydlvPsvvf..tdPeiAsvGlteeeakeag
00487711   1/2  ----------------------------------------------------------------------
00396641   1/2  ----------------------------------------------------------------------
00406021   1/2  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00464461   1/3  ----------------------------------------------------------------------
00375101   1/1  ----------------------------------------ydlvPtvvf..tdPeiAsvGlteeeakeag
00380761   1/1  ----------------------------------------ydaiPsvvf..tdPeiAsvGlteeeakeag
00490031   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00462701   1/2  ----------------------------------------------------------------------
00476821   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00464462   2/3  ----------------------------------------------------------------------
00455201   1/1  ----------------------------------------YdaiPsvvf..tdPeiAsvGlteeeakeag
00452431   1/1  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00351301   1/1  ---------------------------------------DydliPtvvf..tdPeiAsvGlteeeakeag
00466731   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00481021   1/1  sgipvgtlallseiiee-----------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00384501   1/1  ----------------------------------------ydaiPtvvf..tdPeiAsVGlteeeakeag
00484141   1/1  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00387841   1/1  laealkka....gpgrivvvsspagllglpalkvygaskaav----------------------------
00481861   1/1  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00355351   1/1  llaallegvlalagldv-----------------------------------------------------
00480351   1/1  lld-------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00475211   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475642   2/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00485832   2/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           FWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALRIDVLAALLHREGSVEDLLAL
00374411   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00470221   1/1  galasgrlaaea----------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00520321   1/1  Grlaaeaiag------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00485831   1/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00465142   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00475641   1/2  ----------------------------------------------------------------------
00467602   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00484942   2/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00533212   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00440982   2/2  ----------------------------------------------------------------------
00487712   2/2  Gawsn.ellellglel------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00413941   1/1  idvkvvtlpfsdrpralpgeteglvklvvdkdtgriLGaqivgpegaselinvlalaiqagltvedLalt
00482002   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00490032   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00529262   2/2  ----------------------------------------------------------------------
00406022   2/2  ----------------------------------------------------------------------
00462702   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00396642   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00458812   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00468342   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00509272   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00465792   2/2  ----------------------------------------------------------------------
00476822   2/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00464463   3/3  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00368901   1/1  idvkvvtlpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinllalaiklgltvedlad
00472701   1/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00457952   2/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00509271   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00418871   1/1  idvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaiklgltvedlad
00523132   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00529632   2/2  nldllplykhlfppkgkrvvviGg----------------------------------------------
00395041   1/1  idvkvvtlpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaiklgltvedlad
00503641   1/2  ----------------------------------------------------------------------
00471411   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00410231   1/1  idvkvvkfpfaanallllllekeeksllllralalgetegfvKlvvdkdtgrilGahivG.pgageline
00368891   1/2  ----------------------------------------------------------------------
00471412   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00468341   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00484941   1/2  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00366551   1/1  idvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinllalaiklgltvedlad
00424461   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00455331   1/1  idvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaiklgltvedlad
00480451   1/2  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00503642   2/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00406041   1/1  idvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaiklgltvedlad
00406881   1/2  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00465791   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00533211   1/2  ----------------------------------------------------------------------
00406901   1/1  idvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaielgltvedlad
00479921   1/1  ----------------------------------------------------------------------
00458811   1/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00509281   1/1  idvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pdagelinllalaiklgltvedlad
00487711   1/2  ----------------------------------------------------------------------
00396641   1/2  ----------------------------------------------------------------------
00406021   1/2  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00464461   1/3  ----------------------------------------------------------------------
00375101   1/1  idvkvgklpfaalgralalgeategfvklvvdkdtgrilGahivg.pgAgelinelalaiklgltvedla
00380761   1/1  idenvkvvklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaiklgltvedl
00490031   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00462701   1/2  ----------------------------------------------------------------------
00476821   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00464462   2/3  ----------------------------------------------------------------------
00455201   1/1  ieedvkvgklpfaalgralalgetegfvklvvdkdtgrilGahivg.pgagelinelalaiklgltvedl
00452431   1/1  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00351301   1/1  idvkvgklpfaalgralalgeltegfvKlvvdkdtgrilGahivg.pnAgelinelalaiklgltvedla
00466731   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00384501   1/1  iddnlevkvgkfpfaalgralalgetegfvklvvdkdtgrilGahivg.pnageliqelalaiklgltve
00484141   1/1  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00475211   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475642   2/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00485832   2/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DLAYAPPFSPVWDPLLIAAQQAR-----------------------------------------------
00374411   1/1  ----------------------------------------------------------------------
00435771   1/1  ----------------------------------------------------------------------
00491501   1/1  ----------------------------------------------------------------------
00481992   2/2  ----------------------------------------------------------------------
00470681   1/2  ----------------------------------------------------------------------
00400491   1/1  ----------------------------------------------------------------------
00470221   1/1  ----------------------------------------------------------------------
00503631   1/1  ----------------------------------------------------------------------
00458701   1/1  ----------------------------------------------------------------------
00462741   1/1  ----------------------------------------------------------------------
00360921   1/1  ----------------------------------------------------------------------
00467501   1/2  ----------------------------------------------------------------------
00400351   1/1  ----------------------------------------------------------------------
00363002   2/2  ----------------------------------------------------------------------
00472702   2/2  ----------------------------------------------------------------------
00488652   2/2  ----------------------------------------------------------------------
00382852   2/2  ----------------------------------------------------------------------
00520321   1/1  ----------------------------------------------------------------------
00359891   1/1  ----------------------------------------------------------------------
00485831   1/2  ----------------------------------------------------------------------
00483642   2/2  ----------------------------------------------------------------------
00499901   1/1  ----------------------------------------------------------------------
00488662   2/2  ----------------------------------------------------------------------
00470291   1/1  ----------------------------------------------------------------------
00526001   1/1  ----------------------------------------------------------------------
00465142   2/2  ----------------------------------------------------------------------
00509602   2/2  ----------------------------------------------------------------------
00501482   2/2  ----------------------------------------------------------------------
00376432   2/2  ----------------------------------------------------------------------
00406601   1/1  ----------------------------------------------------------------------
00380742   2/2  ----------------------------------------------------------------------
00463442   2/2  ----------------------------------------------------------------------
00364592   2/2  ----------------------------------------------------------------------
00475641   1/2  ----------------------------------------------------------------------
00467602   2/2  ----------------------------------------------------------------------
00471332   2/2  ----------------------------------------------------------------------
00480161   1/1  ----------------------------------------------------------------------
00413411   1/1  ----------------------------------------------------------------------
00473271   1/1  ----------------------------------------------------------------------
00461561   1/1  ----------------------------------------------------------------------
00484942   2/2  ----------------------------------------------------------------------
00483561   1/1  ----------------------------------------------------------------------
00363012   2/2  ----------------------------------------------------------------------
00533212   2/2  ----------------------------------------------------------------------
00475652   2/2  ----------------------------------------------------------------------
00485842   2/2  ----------------------------------------------------------------------
00455182   2/2  ----------------------------------------------------------------------
00483652   2/2  ----------------------------------------------------------------------
00461281   1/1  ----------------------------------------------------------------------
00533222   2/2  ----------------------------------------------------------------------
00406882   2/2  ----------------------------------------------------------------------
00480092   2/2  ----------------------------------------------------------------------
00479092   2/2  ----------------------------------------------------------------------
00509612   2/2  ----------------------------------------------------------------------
00366542   2/2  ----------------------------------------------------------------------
00424462   2/2  ----------------------------------------------------------------------
00457972   2/2  ----------------------------------------------------------------------
00455192   2/2  ----------------------------------------------------------------------
00464162   2/2  ----------------------------------------------------------------------
00368892   2/2  ----------------------------------------------------------------------
00440982   2/2  ----------------------------------------------------------------------
00487712   2/2  ----------------------------------------------------------------------
00406192   2/2  ----------------------------------------------------------------------
00480452   2/2  ----------------------------------------------------------------------
00413941   1/1  dlayhPtlsealdllalaalva------------------------------------------------
00482002   2/2  ----------------------------------------------------------------------
00457982   2/2  ----------------------------------------------------------------------
00419402   2/2  ----------------------------------------------------------------------
00490032   2/2  ----------------------------------------------------------------------
00481082   2/2  ----------------------------------------------------------------------
00469722   2/2  ----------------------------------------------------------------------
00384492   2/2  ----------------------------------------------------------------------
00529262   2/2  ----------------------------------------------------------------------
00406022   2/2  ----------------------------------------------------------------------
00462702   2/2  ----------------------------------------------------------------------
00447052   2/2  ----------------------------------------------------------------------
00396642   2/2  ----------------------------------------------------------------------
00469732   2/2  ----------------------------------------------------------------------
00458812   2/2  ----------------------------------------------------------------------
00472712   2/2  ----------------------------------------------------------------------
00444131   1/1  ----------------------------------------------------------------------
00360162   2/2  ----------------------------------------------------------------------
00477122   2/2  ----------------------------------------------------------------------
00488651   1/2  ----------------------------------------------------------------------
00496792   2/2  ----------------------------------------------------------------------
00468342   2/2  ----------------------------------------------------------------------
00467612   2/2  ----------------------------------------------------------------------
00509272   2/2  ----------------------------------------------------------------------
00460572   2/2  ----------------------------------------------------------------------
00483641   1/2  ----------------------------------------------------------------------
00457971   1/2  ----------------------------------------------------------------------
00486072   2/2  ----------------------------------------------------------------------
00374372   2/2  ----------------------------------------------------------------------
00486071   1/2  ----------------------------------------------------------------------
00492221   1/2  ----------------------------------------------------------------------
00465792   2/2  ----------------------------------------------------------------------
00476822   2/2  ----------------------------------------------------------------------
00363001   1/2  ----------------------------------------------------------------------
00464463   3/3  ----------------------------------------------------------------------
00529631   1/2  ----------------------------------------------------------------------
00509601   1/2  ----------------------------------------------------------------------
00368901   1/1  tifah.Ptlsealveallaa--------------------------------------------------
00472701   1/2  ----------------------------------------------------------------------
00384682   2/2  ----------------------------------------------------------------------
00440981   1/2  ----------------------------------------------------------------------
00457952   2/2  ----------------------------------------------------------------------
00364591   1/2  ----------------------------------------------------------------------
00492222   2/2  ----------------------------------------------------------------------
00509271   1/2  ----------------------------------------------------------------------
00523131   1/2  ----------------------------------------------------------------------
00418871   1/1  tihah.Ptlsealveaalaalgall---------------------------------------------
00523132   2/2  ----------------------------------------------------------------------
00504431   1/1  ----------------------------------------------------------------------
00529632   2/2  ----------------------------------------------------------------------
00395041   1/1  tihah.Ptlsealveaalaalga-----------------------------------------------
00503641   1/2  ----------------------------------------------------------------------
00471411   1/2  ----------------------------------------------------------------------
00376431   1/2  ----------------------------------------------------------------------
00529111   1/2  ----------------------------------------------------------------------
00410231   1/1  lalaiklgltvddladtdlifah-----------------------------------------------
00368891   1/2  ----------------------------------------------------------------------
00471412   2/2  ----------------------------------------------------------------------
00488661   1/2  ----------------------------------------------------------------------
00463571   1/1  ----------------------------------------------------------------------
00488072   2/2  ----------------------------------------------------------------------
00468341   1/2  ----------------------------------------------------------------------
00480091   1/2  ----------------------------------------------------------------------
00533221   1/2  ----------------------------------------------------------------------
00380741   1/2  ----------------------------------------------------------------------
00484941   1/2  ----------------------------------------------------------------------
00488071   1/2  ----------------------------------------------------------------------
00454812   2/2  ----------------------------------------------------------------------
00501481   1/2  ----------------------------------------------------------------------
00455191   1/2  ----------------------------------------------------------------------
00529261   1/2  ----------------------------------------------------------------------
00366551   1/1  tihah.Ptlsealveaalaal-------------------------------------------------
00424461   1/2  ----------------------------------------------------------------------
00485841   1/2  ----------------------------------------------------------------------
00455331   1/1  tihah.Ptlsealveaalaalgl-----------------------------------------------
00480451   1/2  ----------------------------------------------------------------------
00533831   1/1  ----------------------------------------------------------------------
00479091   1/2  ----------------------------------------------------------------------
00482001   1/2  ----------------------------------------------------------------------
00384491   1/2  ----------------------------------------------------------------------
00503642   2/2  ----------------------------------------------------------------------
00455181   1/2  ----------------------------------------------------------------------
00475651   1/2  ----------------------------------------------------------------------
00406041   1/1  tihah.Ptlsealveaalaa--------------------------------------------------
00406881   1/2  ----------------------------------------------------------------------
00445591   1/1  ----------------------------------------------------------------------
00477121   1/2  ----------------------------------------------------------------------
00467611   1/2  ----------------------------------------------------------------------
00529112   2/2  ----------------------------------------------------------------------
00472711   1/2  ----------------------------------------------------------------------
00465141   1/2  ----------------------------------------------------------------------
00366541   1/2  ----------------------------------------------------------------------
00483651   1/2  ----------------------------------------------------------------------
00481081   1/2  ----------------------------------------------------------------------
00469721   1/2  ----------------------------------------------------------------------
00496791   1/2  ----------------------------------------------------------------------
00469731   1/2  ----------------------------------------------------------------------
00457981   1/2  ----------------------------------------------------------------------
00509611   1/2  ----------------------------------------------------------------------
00464161   1/2  ----------------------------------------------------------------------
00457951   1/2  ----------------------------------------------------------------------
00465791   1/2  ----------------------------------------------------------------------
00529642   2/2  ----------------------------------------------------------------------
00363011   1/2  ----------------------------------------------------------------------
00472761   1/1  ----------------------------------------------------------------------
00419401   1/2  ----------------------------------------------------------------------
00471331   1/2  ----------------------------------------------------------------------
00533211   1/2  ----------------------------------------------------------------------
00406901   1/1  tihah.Ptlsealveaala---------------------------------------------------
00479921   1/1  ----------------------------------------------------------------------
00458811   1/2  ----------------------------------------------------------------------
00472782   2/2  ----------------------------------------------------------------------
00509281   1/1  tifah.Ptlsealveaalall-------------------------------------------------
00487711   1/2  ----------------------------------------------------------------------
00396641   1/2  ----------------------------------------------------------------------
00406021   1/2  ----------------------------------------------------------------------
00486871   1/1  ----------------------------------------------------------------------
00464461   1/3  ----------------------------------------------------------------------
00375101   1/1  dtihah.Ptlsealveaal---------------------------------------------------
00380761   1/1  adtihah.Ptlsealv------------------------------------------------------
00490031   1/2  ----------------------------------------------------------------------
00447051   1/2  ----------------------------------------------------------------------
00462701   1/2  ----------------------------------------------------------------------
00476821   1/2  ----------------------------------------------------------------------
00382851   1/2  ----------------------------------------------------------------------
00467601   1/2  ----------------------------------------------------------------------
00425341   1/1  ----------------------------------------------------------------------
00406191   1/2  ----------------------------------------------------------------------
00423422   2/2  ----------------------------------------------------------------------
00482271   1/1  ----------------------------------------------------------------------
00460571   1/2  ----------------------------------------------------------------------
00464462   2/3  ----------------------------------------------------------------------
00455201   1/1  adtihah.Ptlsealv------------------------------------------------------
00452431   1/1  ----------------------------------------------------------------------
00384681   1/2  ----------------------------------------------------------------------
00351301   1/1  dtihah.Ptlsealveaal---------------------------------------------------
00466731   1/1  ----------------------------------------------------------------------
00423401   1/1  ----------------------------------------------------------------------
00481021   1/1  ----------------------------------------------------------------------
00531721   1/1  ----------------------------------------------------------------------
00384501   1/1  dladtihah.Ptlsealveaa-------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00481991   1/2  ----------------------------------------------------------------------
00387841   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00367852   2/2  ----------------------------------------------------------------------
00355351   1/1  ----------------------------------------------------------------------
00480351   1/1  ----------------------------------------------------------------------
00366641   1/1  ----------------------------------------------------------------------
00528371   1/1  ----------------------------------------------------------------------
00475211   1/1  ----------------------------------------------------------------------
00374371   1/2  ----------------------------------------------------------------------
00470682   2/2  ----------------------------------------------------------------------
00360161   1/2  ----------------------------------------------------------------------
00467502   2/2  ----------------------------------------------------------------------
00529641   1/2  ----------------------------------------------------------------------
00472781   1/2  ----------------------------------------------------------------------
00463441   1/2  ----------------------------------------------------------------------
00475642   2/2  ----------------------------------------------------------------------
00454811   1/2  ----------------------------------------------------------------------
00485832   2/2  ----------------------------------------------------------------------
00367851   1/2  ----------------------------------------------------------------------
00423421   1/2  ----------------------------------------------------------------------