[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81963.1


[Show Plain Result]

## Summary of Sequence Search
   1::361
   9::343  2.4e-76 33.1% 0042214 00422141 1/1   p containing nucleoside triphosphate hy 
   2::237  4.8e-66 41.7% 0050361 00503611 1/1   p containing nucleoside triphosphate hy 
   7::282  1.7e-59 31.1% 0037960 00379601 1/1   p containing nucleoside triphosphate hy 
 121::241  1.8e-26 31.9% 0051138 00511381 1/1   p containing nucleoside triphosphate hy 
 121::250  2.7e-19 21.9% 0047073 00470731 1/1   p containing nucleoside triphosphate hy 
 108::247  8.4e-16 20.0% 0043986 00439861 1/1   p containing nucleoside triphosphate hy 
 125::271  1.6e-13 21.1% 0041412 00414121 1/1   p containing nucleoside triphosphate hy 
 126::229  5.9e-13 30.1% 0051942 00519421 1/1   p containing nucleoside triphosphate hy 
 106::248  9.5e-11 23.6% 0036748 00367481 1/1   p containing nucleoside triphosphate hy 
 119::274  1.2e-10 20.0% 0048266 00482661 1/1   p containing nucleoside triphosphate hy 
  57::206  6.1e-09 22.3% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
 108::244  5.6e-07 22.5% 0036729 00367291 1/1   p containing nucleoside triphosphate hy 
 128::245  1.3e-06 23.7% 0051289 00512891 1/1   p containing nucleoside triphosphate hy 
 123::211  2.2e-06 19.4% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
 124::217  4.4e-06 26.1% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
 122::247  8.3e-06 22.6% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
  78::312  1.3e-05 19.3% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 125::206  1.4e-05 20.7% 0044893 00448931 1/1   p containing nucleoside triphosphate hy 
 125::208  2.4e-05 24.4% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
 124::256  3.4e-05 20.3% 0049825 00498251 1/1   p containing nucleoside triphosphate hy 
  81::148  6.5e-05 23.5% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
 126::229  6.5e-05 25.6% 0046895 00468951 1/1   p containing nucleoside triphosphate hy 
 124::154  0.00011 29.0% 0045731 00457311 1/1   p containing nucleoside triphosphate hy 
 124::164  0.00012 30.8% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
 109::209  0.00013 18.8% 0044438 00444381 1/1   p containing nucleoside triphosphate hy 
 117::258  0.00014 19.0% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 124::253  0.00016 20.3% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
 123::266  0.00017 17.4% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
 124::180  0.00018 19.6% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
 126::205  0.00025 25.0% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
 124::154  0.00028 35.5% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
 128::206   0.0003 21.5% 0051376 00513761 1/1   p containing nucleoside triphosphate hy 
 116::208  0.00033 17.7% 0042094 00420941 1/1   p containing nucleoside triphosphate hy 
 120::232  0.00034 17.6% 0034832 00348321 1/1   p containing nucleoside triphosphate hy 
 127::249  0.00038 22.6% 0048381 00483811 1/1   p containing nucleoside triphosphate hy 
 128::228   0.0004 18.1% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
 126::229  0.00046 24.4% 0051056 00510561 1/1   p containing nucleoside triphosphate hy 
 119::161  0.00048 32.6% 0052004 00520041 1/1   p containing nucleoside triphosphate hy 
 124::207  0.00052 24.4% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
 126::229  0.00054 23.2% 0049853 00498531 1/1   p containing nucleoside triphosphate hy 
 102::271  0.00056 17.2% 0037996 00379961 1/1   p containing nucleoside triphosphate hy 
 115::233  0.00064 24.1% 0049837 00498371 1/1   p containing nucleoside triphosphate hy 
 126::216  0.00069 20.9% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
 124::250  0.00073 21.8% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
 112::208  0.00077 24.1% 0039270 00392701 1/1   p containing nucleoside triphosphate hy 
 126::208  0.00093 20.3% 0052155 00521551 1/1   p containing nucleoside triphosphate hy 
 125::254  0.00095 20.0% 0050374 00503741 1/1   p containing nucleoside triphosphate hy 
 100::147  0.00096 31.8% 0037230 00372301 1/1   p containing nucleoside triphosphate hy 
   1::361


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEE
00422141   1/1  --------dlsleelekllelllrdllglgplvklldplleeavvngasdihiepgggllrvryridgvl
00503611   1/1  -pvvlllnpllllavdlgasdihielglpirlridGvlvaldvlplllaellilllrivqdlgrellees
00379601   1/1  ------llllpllllpdeplaaldvalqralvslerllellvdpgasdihinpggpvrvridgvlelllv
00511381   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00503561   1/1  --------------------------------------------------------kPydrLldivgigf
00367291   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
00422141   1/1  iel..ifldeeellallsrlkslaglpilearlpqggriqavlppvvvdfrvstlpdigglslvirklre
00503611   1/1  levdlrlsdggvvrvrvsvlpllgglglmLrll.....sirnlalppvliellelefgsGltvltGeTGa
00379601   1/1  vldllsldleellalasriavlagrdiserrlpldgal.lpdgsrvrvrlsplptllggeslvirklpkl
00511381   1/1  --------------------------------------------------llllkpgglvlitGPtgsGK
00470731   1/1  --------------------------------------------------arpltfddvvgqdeakeele
00439861   1/1  -------------------------------------kleeveristgipeldellgGglpkgslilitG
00414121   1/1  ------------------------------------------------------kpgevvllvGpsGaGK
00519421   1/1  -------------------------------------------------------pgglvlitGpmgsGK
00367481   1/1  -----------------------------------yvrPelldepllelengrhPllsksyggkvvlndi
00482661   1/1  ------------------------------------------------kkvaivllsnyalsislddlll
00503561   1/1  ltaddialalgiagdsperlllalallsellgeghlylplddlveellklleldelllelieleellkel
00367291   1/1  -------------------------------------vtlddvvgqeeakeallealelalkgldlflsl
00512891   1/1  ---------------------------------------------------------evilltGppGvGK
00420081   1/1  ----------------------------------------------------smkkglrIaleGpsGvGK
00487061   1/1  -----------------------------------------------------ldMkkgklIvieGppGs
00437981   1/1  ---------------------------------------------------lalkpgeiphalllvGppG
00437941   1/1  -------lrplveklrpknlddvygqeevlkalslale.................kgrpehlllvGppGt
00448931   1/1  ------------------------------------------------------Lddvslsvepgevial
00477561   1/1  ------------------------------------------------------kkpkvillvGppGsGK
00498251   1/1  -----------------------------------------------------vekllglalllieklfl
00368571   1/1  ----------llgvrllpplppklagllplagladgdglgvllGklldgvpvtldlgelgrhllivGptG
00468951   1/1  -------------------------------------------------------lnvlgesidalgkil
00457311   1/1  -----------------------------------------------------mkkgeiigivGpsGsGK
00464421   1/1  -----------------------------------------------------MkkgkfIvieGpdGsGK
00444381   1/1  --------------------------------------asdelekllelrpvlledvigqeeakkalsla
00527261   1/1  ----------------------------------------------npfilgpkvdledfigreeelkel
00489631   1/1  -----------------------------------------------------M.kgklillvGppGsGK
00472911   1/1  ----------------------------------------------------mkmkkgklilltGppGsG
00475381   1/1  -----------------------------------------------------mkge.iialtGpsGsGK
00496571   1/1  -------------------------------------------------------GkgelivllGpsGsG
00434401   1/1  -----------------------------------------------------Mlsksyggllalddvsl
00513761   1/1  ---------------------------------------------------------kiiaivGkgGsGK
00420941   1/1  ---------------------------------------------ldlglslgirpgkgvllyGppGtGK
00348321   1/1  -------------------------------------------------ilealrsgrvvllvgptGsGK
00483811   1/1  --------------------------------------------------------PkvillsGpPGvGK
00478131   1/1  ---------------------------------------------------------kgkvivltGppGs
00510561   1/1  -------------------------------------------------------ldglgepldgllpil
00520041   1/1  ------------------------------------------------iipallsgrdvvllaaptGsGK
00459701   1/1  -----------------------------------------------------M.pkvillv.GppGsGK
00498531   1/1  -------------------------------------------------------ldklgkildlalkil
00379961   1/1  -------------------------------yrpvdfddivGqeealralslalaagppegvllvGppGt
00498371   1/1  --------------------------------------------kLnpeQreairaaggpllvqGppGTG
00499191   1/1  -------------------------------------------------------kgkiigitGpsGsGK
00478391   1/1  -----------------------------------------------------msikkgklilltGppGs
00392701   1/1  -----------------------------------------eklrpvllddvvgqeeakeallealagar
00521551   1/1  -------------------------------------------------------pgkgvlLvGppGtGK
00503741   1/1  ------------------------------------------------------fifldlrplallplpd
00372301   1/1  -----------------------------yvlPllsdgmpllelenlrkpyggllvlndvsl....pgei


                         +         -         -         -         -         *         -:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
00422141   1/1  viltledlglsygdpealkdlslaippgglvlltGptGsGKtTllralagllnpd.egriltiedpieyv
00503611   1/1  GKStlLdAlglllGgradldlirsgedraiit.efpielvldlddelilrreigadgrsrarleingrpv
00379601   1/1  iltledllelenlsfsyggkealkdlslaiepgelvlivGptGsGKTTllkallgllppd..egiitieg
00511381   1/1  sttLlralnrleeagkgvilvkdaidtrlgielvvsriglvleavglffaldllelll.....qdpdvil
00470731   1/1  ellagllgikkpkvillvGppGsGKTTlaralakel..gagfilidgddlrekavgeleklgrdlfqvar
00439861   1/1  ppGsGKTtlalqlaanlaknggkvlyisleesreqlleraerlgldleellllgllsiliadplglsgee
00414121   1/1  TTLlrallglleglkvaviepdfgeilidgqlledlgvlavrlgigyvpqtlglfpaltvlellalalll
00519421   1/1  Ttlllrllkrleeagkk.vlvfkpaldtrylglvasriglsleailvtllldlfelllrlllrgdidvil
00367481   1/1  .slsip.gellvitGPngsGKSTllralaglllpasggilvpgedalllrvdeiltrvglsdlldrgls.
00482661   1/1  ildlykevqvaydnfykvdesdiayqyallakedenaaaflksnrqkklvrdladrviaeerlellekii
00503561   1/1  leeilvellkedlelvlderrlyleeleldelglaellkelleelei.deklldkilddlegilpl----
00367291   1/1  glrpgrnvllyGppGtGKTtlaralanel.............gapfirvdaselle.klvgegegrlrga
00512891   1/1  TTlakalagelgakfgsvsltgrdvrsarrgigyvfqtveellgllaelvglevrgeleellktlikels
00420081   1/1  TTlaklLarhlg.ptggrvllvgEPiaywrsv................ggsdlleliyqlplrldlgeis
00487061   1/1  GKtTlakaLaer.gargldvvviyepvdywaavgggdllrlirelllrlgfgepdafdn.ellgelleal
00437981   1/1  sGKttlaralagllgpdsgkilldgkdirrgiglvfqliglfphltvlelvalgl...........ggil
00437941   1/1  GKTtlakalaglllptsggvrvlgidaselld.........pselsggerqrvliaralladpkvlllDE
00448931   1/1  vGpnGsGKTTllnalagllapdggkvllvgadiarlaareqlgivfqdpgltvlenlalgeleara----
00477561   1/1  tTlaraLakrlaelgk.gvvvidtddlrralifqdeldlfdedree..gfrvpeelvrellkellarl--
00498251   1/1  kvlprllsllelenlskiytgipaldvslglgGlppGeivlllGpsGsGKTtLalrllagllkpgggvvy
00368571   1/1  sGKStllr--------------------------------------------------------------
00468951   1/1  seilkllekgfltalgllerksverlstgikaLDlllgiGglprGelvlivGppGsGKTtlalqlaanla
00457311   1/1  STlarllagllekp--------------------------------------------------------
00464421   1/1  TTlaklLae.l.elgigvvvtrEP----------------------------------------------
00444381   1/1  lelplkrlelfgklddligrspairrllell..garpgenvlLvGppGtGKTtlakalakll..gvpfi-
00527261   1/1  eeal...pkivlltGprGsGKTtllkalakel..gkpviyidlselsskgyvdleellrelaeelgelle
00489631   1/1  tTlaraLaellglpf.....iridgddllrellgellgrgigfgfqqgdlledatvlenlalllldeidk
00472911   1/1  KtTlaraLaellgapfisgddllrglageggkplgllfedaleagfrqrladlirallakgkvvildgtg
00475381   1/1  sTlarlLagllkptsgivsvdglrlavlsrdllgllregl------------------------------
00496571   1/1  KsTlarlLagll....ggsvldtgepirgeplgelirglvfqdpllldeltvlenlalgrylhlg-----
00434401   1/1  svkkgliigitGps--------------------------------------------------------
00513761   1/1  TTllnklaglladggkvlvidlDparanlpeqlgidirdlidletvmelglgpngalvfaleellt----
00420941   1/1  Ttlakalagel..gapfiridgsellg............kyvgelsgglrqllalaraakpsilllDE--
00348321   1/1  Ttlalalalel....ggrvlvlvptralaeqlaerlakllglrvgllvgylirfestrilvvtyglllrl
00483811   1/1  TtlaaaLakyLks.................qgldvlvldldellrgllgqpklydlleellellldegek
00478131   1/1  GKtTlarlLaellkplglgvvvidgddlrreavgqlglglsieelde..................alllp
00510561   1/1  aklfrpievlalgllerksverlstGikaLDlllgiGglprGelvliaGppGsGKTtlalqlaanlaaqg
00520041   1/1  Tlaallpilelllegggrvlv-------------------------------------------------
00459701   1/1  TTlakaLakrlgekgvkvvvidtddlrreaikqliglg.lfdedgegalrrreavakllldallkal---
00498531   1/1  eksflklevlalgvlerkeverlstGikaLDallgiGglprGsltliaGppGsGKTtlalqlaanlaklg
00379961   1/1  GKstlaralagllppdsgrivlvgnlsdlldpkdlrellragiplvflnfaalpasllesellsggerqr
00498371   1/1  KTttlvariaylllegg..................................lppkrilvvtftnaaadel
00499191   1/1  sTlaklLaellgatvgdvdgllvgvvfqddfylllpalevlengaflldlllpdaldrelllelllalve
00478391   1/1  GKtTlaralaerl...glpvidgddllrelvgeggrlgrdlfdedrllfrellideidlllakgkvvild
00392701   1/1  laledlslgirpgknvlLvGppGvGKTtlaralagll..gapfgrvdasdllg............kyv--
00521551   1/1  Ttlaralagll..gapfvrlsaselvg............kyvgelegglrqllalaraanpgvlflDE--
00503741   1/1  rlvgrdeeiealskalggaldgvslsiepggivllvGppGvGKTtLakllagllkpkfgeillfgkvvyv
00372301   1/1  valtGpn---------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           DYETIAAAITAAETGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG
00422141   1/1  fqspnlfplqlsgG...qrqrvalaralrqdPdvillDEprsaldaelllqaadtGhtvlvttHdlsaar
00503611   1/1  tlgvlrelgellvdihgqhehqaLraa-------------------------------------------
00379601   1/1  pdel.lrnkigyvfQdpvlfp.ltvrenlaralrqdPdilllDEptsaldae.llqalltghtvvlvthh
00511381   1/1  iDEaqfldpevvevlleladtgilvlvtgle---------------------------------------
00470731   1/1  egglvpdilfideidallrkgpdvildgagrtpeqleall------------------------------
00439861   1/1  llrvllalalelkpdlliiDeltalldaervrelrel---------------------------------
00414121   1/1  redpdlilidsgGqkqrlalaralladpdlgellllDeptlvlDaasgedlldllkelaeq---------
00519421   1/1  iDEaqflddelveqlrlla---------------------------------------------------
00367481   1/1  lsggerqrvalaralatdpslllLDEptsgldpedgaa--------------------------------
00482661   1/1  eellrirldklledldeiveelppvlfddlvgqeeakeallenlklflkgpellldlglpkgrg------
00503561   1/1  ----------------------------------------------------------------------
00367291   1/1  laealradpgvlflDEidalagkrgsgtsrldpe------------------------------------
00512891   1/1  ggekqrvalarallakpdvlllDEidgldpdvlea-----------------------------------
00420081   1/1  l---------------------------------------------------------------------
00487061   1/1  leggkiv---------------------------------------------------------------
00437981   1/1  veevrellkellsgGqkqrvaiaralagdpkvlllDE---------------------------------
00437941   1/1  i.dal.......................dpeaqnaLlklleel.........pkgvtvilttnrleeldp
00448931   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00498251   1/1  idgeesldllrarrlgvvlqelllfpeltveenldrlprllsggqr------------------------
00368571   1/1  ----------------------------------------------------------------------
00468951   1/1  klggkvlyidteesldqlr---------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00527261   1/1  llkkllkklsellglsilglelilglsggdleelleelaellkklgkp----------------------
00489631   1/1  aledggvvlldgfdrsqlqrlailrallddppdlvvfldaple---------------------------
00472911   1/1  lsreareellellkelgpvlvifldadpevlleRllkrgrallreevldrllevre--------------
00475381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00348321   1/1  l.dlllsdfdliiiDEahelsa------------------------------------------------
00483811   1/1  ipveliiellkdvlvsdpdviilDelpgtnlklqdletl-------------------------------
00478131   1/1  dalrralleealealkag----------------------------------------------------
00510561   1/1  gkvlyisteesleql....---------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00498531   1/1  gkvlyisteesleql....---------------------------------------------------
00379961   1/1  valaralalrpGllvlAdggvlllDEp.daldpevqaaLlrlleegevtieragitlllpa---------
00498371   1/1  rer..llkllgelgldgvevstf-----------------------------------------------
00499191   1/1  glvvll----------------------------------------------------------------
00478391   1/1  gtnlsealdealrrllrpdlvifldapleelleRllkrgr------------------------------
00392701   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00503741   1/1  nvselldlkellrlllealglpppyqlsggerlrvalaeallal--------------------------
00372301   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACLADLYRRKLITYEMGLARAVDPKEFM
00422141   1/1  aadrllvlgdg......rlllasaldviiaqnlvrrldpalrrpgrldrivevgtpeellanp-------
00503611   1/1  ----------------------------------------------------------------------
00379601   1/1  ln--------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437941   1/1  allsRfdviefpppdeeelleilklilkkegl--------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RLAGAPEGARR-----------------------------------------------------------
00422141   1/1  ----------------------------------------------------------------------
00503611   1/1  ----------------------------------------------------------------------
00379601   1/1  ----------------------------------------------------------------------
00511381   1/1  ----------------------------------------------------------------------
00470731   1/1  ----------------------------------------------------------------------
00439861   1/1  ----------------------------------------------------------------------
00414121   1/1  ----------------------------------------------------------------------
00519421   1/1  ----------------------------------------------------------------------
00367481   1/1  ----------------------------------------------------------------------
00482661   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00367291   1/1  ----------------------------------------------------------------------
00512891   1/1  ----------------------------------------------------------------------
00420081   1/1  ----------------------------------------------------------------------
00487061   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00448931   1/1  ----------------------------------------------------------------------
00477561   1/1  ----------------------------------------------------------------------
00498251   1/1  ----------------------------------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00468951   1/1  ----------------------------------------------------------------------
00457311   1/1  ----------------------------------------------------------------------
00464421   1/1  ----------------------------------------------------------------------
00444381   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00489631   1/1  ----------------------------------------------------------------------
00472911   1/1  ----------------------------------------------------------------------
00475381   1/1  ----------------------------------------------------------------------
00496571   1/1  ----------------------------------------------------------------------
00434401   1/1  ----------------------------------------------------------------------
00513761   1/1  ----------------------------------------------------------------------
00420941   1/1  ----------------------------------------------------------------------
00348321   1/1  ----------------------------------------------------------------------
00483811   1/1  ----------------------------------------------------------------------
00478131   1/1  ----------------------------------------------------------------------
00510561   1/1  ----------------------------------------------------------------------
00520041   1/1  ----------------------------------------------------------------------
00459701   1/1  ----------------------------------------------------------------------
00498531   1/1  ----------------------------------------------------------------------
00379961   1/1  ----------------------------------------------------------------------
00498371   1/1  ----------------------------------------------------------------------
00499191   1/1  ----------------------------------------------------------------------
00478391   1/1  ----------------------------------------------------------------------
00392701   1/1  ----------------------------------------------------------------------
00521551   1/1  ----------------------------------------------------------------------
00503741   1/1  ----------------------------------------------------------------------
00372301   1/1  ----------------------------------------------------------------------