[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81982.1


[Show Plain Result]

## Summary of Sequence Search
   1::414
   1::281  2.1e-87 46.2% 0041699 00416991 1/1   like peptide ligases, catalytic domain  
  16::295  4.9e-68 45.5% 0052866 00528661 1/1   like peptide ligases, catalytic domain  
  24::279  1.6e-40 38.9% 0042137 00421371 1/1   like peptide ligases, catalytic domain  
  34::280  1.3e-38 38.4% 0038085 00380851 1/1   like peptide ligases, catalytic domain  
  28::276  9.9e-31 32.8% 0045483 00454831 1/1   like peptide ligases, catalytic domain  
 282::415  4.2e-25 42.7% 0041698 00416981 1/1   like peptide ligases, peptide-binding d 
 280::406  9.3e-20 42.1% 0052865 00528651 1/1   like peptide ligases, peptide-binding d 
 280::405    5e-15 36.8% 0046486 00464861 1/1   like peptide ligases, peptide-binding d 
 279::411  1.3e-07 29.3% 0039392 00393921 1/1   like peptide ligases, peptide-binding d 
 146::279  2.7e-06 24.4% 0047522 00475222 2/2   like peptide ligases, catalytic domain  
 118::280  5.6e-05 25.6% 0046487 00464872 2/2   like peptide ligases, catalytic domain  
  31::66    0.0012 44.4% 0046487 00464871 1/2   like peptide ligases, catalytic domain  
  20::64      0.12 35.0% 0047522 00475221 1/2   like peptide ligases, catalytic domain  
   1::414


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDPLSWLYARQGRFAPGLERIRALLARLGHPEEAYPVALVGGTNGKGTTARTLAAILEEAGFRVGLYTSP
00416991   1/1  lllmtleealdyllsllplgaidlglervrrllellglpqnalpvihvaGTnGKGstcaflesilraagl
00528661   1/1  ---------------lglealsrlalllgnplkklpviaVtGTnGKttTtallasileaaglkvglytsp
00421371   1/1  -----------------------rlellarllldlpviavtGTnGKTTttallaaileaaglkvgalign
00380851   1/1  ---------------------------------klpviavTGTnGKTTttsllaaileaaglvvaligni
00454831   1/1  ---------------------------dielalllldlpviavTGTnGKTTttsliaailkaaglvvalg
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00475222   2/2  ----------------------------------------------------------------------
00464872   2/2  ----------------------------------------------------------------------
00464871   1/2  ------------------------------PsekltlvGvTGTnGKTtvalllaqllellglkaal----
00475221   1/2  -------------------evlrraell..llrlklsiavaGthGKTTTtsllalvlleagldp------


                         -         -         *         -         -         -         -:140
query           HLVDFRERIQVQGRPIPEEKLLALLAELRPHAERLEASFFEAATALALLHFAREGVEFAVLEVGLGGRLD
00416991   1/1  kvGlytSPhLldfnEriringepisdelllelfeeveaaleeldaegllsltfFelltllafllFaeakv
00528661   1/1  glvlfneriringepisdellarlfeevlnalegnlnlgigvpltpfelltllalllfadegvdvaVlEv
00421371   1/1  inneigerltlg..........................................gvdlaVlEvgssgllf
00380851   1/1  gnl.......................................igvpallllldggvdvaVlEvssfdlgf
00454831   1/1  gnigvp............................................llllllegvdvaVlElssfq
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00475222   2/2  ----------------------------------------------------------------------
00464872   2/2  -----------------------------------------------laelveagvelvvmEvsshgLdq
00464871   1/2  ----------------------------------------------------------------------
00475221   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ATNATEPVLSVVTNVGHDHLEVLGPTLKDVAREKAGIFRGGVPALTAAQGEGLGVLRAEALARKTPLWVL
00416991   1/1  dvavlEvGlGGrlDaTnvidplvavitsiglDHtdlLGdtleeIAleKaGiikpgvpvvlgdqepealev
00528661   1/1  gsgglldatnvldpdvavitniglDHldylgdtleeiaaaKagifkpggpavlnaddplvlavleelaae
00421371   1/1  lt..lrpdvavitnigldHldylggtleaiaaakaeifkglppggvavlnaddpllaelaera...garv
00380851   1/1  lldltnllrpdvavitnigldHldyhg.tleeyaaakaeifkglppggvavlnaddpllaallerla..g
00454831   1/1  l.grlellrpdvavitnispdHldrhgnslenyaaakleifeglgvavlnaddplllalae....lgakv
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ----------------------------------------------------------------------
00464861   1/1  ----------------------------------------------------------------------
00393921   1/1  ----------------------------------------------------------------------
00475222   2/2  -----sPdiavitnidadHldiyggdledllaafleflnnv..gllvlclddplllellgityGls....
00464872   2/2  gRvdgvrfdvavftnltrdHLD.yHgtmeeYlaaKlrLFdllglglavinlddelgalllellsgalllv
00464871   1/2  ----------------------------------------------------------------------
00475221   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEDFHAEGVEALPEGLAFTLRLERTGEALRLTARLLGPHQAENLALAALSGRLLGAGWEAVKRGVARAEN
00416991   1/1  lleraeelgapllllgrdfsllllelalggllllllglgllldlllp..llGehqllNaalAlaalellg
00528661   1/1  vltfgllvgadlraedielsldglrftllgpgglllelelp..llGrhnvlNalaAlaa..........i
00421371   1/1  vtfgldegadlraldivltldgttftlll.pgglllelrlplpGrhnvlNalaAiaaalalgvdleaia-
00380851   1/1  arvvtfglddegadlraldivllldgtsftlllpggll..evelplpgrhnvlNalaAiaaalalgvdle
00454831   1/1  itfgldedadllalllgglllllllgl..lllllelplpglhnvlNalaAiaaalalgvdleaile----
00416981   1/1  ----------------------------------------------------------------------
00528651   1/1  ---------------------------------------------------------------------l
00464861   1/1  ---------------------------------------------------------------------v
00393921   1/1  --------------------------------------------------------------------Gv
00475222   2/2  dadvralnillegggllfdvllkge.llgeltlnlpGrHnvlNalAaiavalllgldleaileaLasFk-
00464872   2/2  ltyglkgdadgallraldlelslsgllltlllpgg..elevslpLlGrfnvyNllaalalllalgldlee
00464871   1/2  ----------------------------------------------------------------------
00475221   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           PGRLQRLLWRGRELLLDGAHNPEGALALREALRFHGLLPAAFVLGFSRDKDHAAMAEALRGLGPVVLTRY
00416991   1/1  l---------------------------------------------------------------------
00528661   1/1  legLasfgvpgRlel-------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00416981   1/1  -GRlevlseggplvilDgAHnpdaaeallealrelfpggrlilvfgalgdkdirgllgllaelfddvviv
00528651   1/1  pGRlevls.ggplvllDgAHnpdaleallealrellpgrlilvfgalgdkdirgllgllaelfddvvivt
00464861   1/1  pGRfevlgevggptvivDyAHnPdaleallealrefpggrliaVfgplgdkdtrkrlemlaialsladvv
00393921   1/1  kgRfellgelevggvlvidDyAHhPdaieatlealrelfpdgrliavfgphgysrdkglrdefaealsla
00475222   2/2  ----------------------------------------------------------------------
00464872   2/2  ----------------------------------------------------------------------
00464871   1/2  ----------------------------------------------------------------------
00475221   1/2  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           ASLRSEDPRALLPLFPGAKVVEDPLEALEEAFSREGRVVVAGSLYLVGEVLRRLEGLPAEERWQ------
00416991   1/1  ----------------------------------------------------------------------
00528661   1/1  ----------------------------------------------------------------------
00421371   1/1  ----------------------------------------------------------------------
00380851   1/1  ----------------------------------------------------------------------
00454831   1/1  ----------------------------------------------------------------------
00416981   1/1  tldnpraedpeelaalllegglnvlviedvaeale...spgdlvlvaGslylvgevlqllggvkl-----
00528651   1/1  ldnprgalpaeilalilevlviadreeaieaaleladgdlvlvaGslylvgevlkl--------------
00464861   1/1  iltdd.nprgedpeelaaallagilgglnvlviadraeaieaalelakpgdvvlv---------------
00393921   1/1  dvviltdvnpagedpieilddillglligglkvlviedreeaielalslakpgdvvlilGa---------
00475222   2/2  ----------------------------------------------------------------------
00464872   2/2  ----------------------------------------------------------------------
00464871   1/2  ----------------------------------------------------------------------
00475221   1/2  ----------------------------------------------------------------------