[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS81992.1


[Show Plain Result]

## Summary of Sequence Search
   1::220
  20::209  2.8e-59 46.8% 0043687 00436871 1/1   reductase molybdopterin-binding domain  
   6::209    1e-58 44.1% 0041847 00418471 1/1   reductase molybdopterin-binding domain  
  29::216  8.1e-56 41.2% 0050934 00509341 1/1   reductase molybdopterin-binding domain  
   1::220


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTWPAFSLGVWGYPEGMDPRVPPGQFVTERFPILTYGETPKVAKEAWRLEVTGLVETPLVLTYEDLLARP
00436871   1/1  -------------------aepplqlllegfitPndlffvrnhggvpgidpedwrLevdGlvekpltltl
00418471   1/1  -----vdygdlstllalverlpllvltlllplnalpplqlltegfitpnnlfyvrnhggvppaidpddwr
00509341   1/1  ----------------------------ldprlvlllllhppnnleplpllllygnitpfglffvrnhgp


                         -         -         *         -         -         -         -:140
query           QVELTRDFHCVTRWSRLDVTWKGVRTRDLLEEARPRPEAVAALVESYGGYTTNLLLEDLLREDVLLAHTL
00436871   1/1  ddLlallplveriarlrCvgnwsavlnlvkkvkglqwglgavstalWtGvpLrdlLelagvkpgdlgaky
00418471   1/1  LevdGlvekpltltlddLlalplveriatlvCvgnwskvinlvkkvkglqwgagavstalWtGvpLrdlL
00509341   1/1  vpeldpddwrLevdGlvekpltlslddLlklfpleeriyrlrCvgnw.sgvapWtGvpLrdlLelagpks


                         +         -         -         -         -         *         -:210
query           FGKPLPPERGGPVRLLVPHLYAWKSAKWVRRIVLLDHLELGFWERLGYHWRGDPWKEERFQEGPVPAHRI
00436871   1/1  vlfegaddlllglgyttslpldealdpnrdvlLAygmnGepLppehGyPlRlvvPglyGfksvKwlvrI-
00418471   1/1  elagvkpklgskklgakyVlfegaddllegpglgYttslpldealdpgrdvlLAyemnGepLppehGyP-
00509341   1/1  gakyvlfegldgpellpgqrsllllglldwpyteslpldealdpdvlLAygmnGepLppehGaPlRlvvP


                         -         -         -         +         -         -         -:280
query           RFAARNKPGR------------------------------------------------------------
00436871   1/1  ----------------------------------------------------------------------
00418471   1/1  ----------------------------------------------------------------------
00509341   1/1  gkyGfk----------------------------------------------------------------