[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for tthe0:AAS82142.1


[Show Plain Result]

## Summary of Sequence Search
   1::285
  83::286  1.1e-24 30.2% 0047462 00474621 1/1   lasmic binding protein-like II          
 100::284  1.6e-23 33.9% 0052509 00525091 1/1   lasmic binding protein-like II          
  82::285  4.1e-22 30.0% 0049998 00499981 1/1   lasmic binding protein-like II          
  82::283  5.1e-22 28.5% 0052806 00528061 1/1   lasmic binding protein-like II          
  82::284  1.7e-21 28.5% 0045790 00457901 1/1   lasmic binding protein-like II          
   1::102  4.5e-21 43.9% 0045910 00459101 1/1   ed helix" DNA-binding domain            
   1::87   1.2e-20 48.3% 0047461 00474611 1/1   ed helix" DNA-binding domain            
  85::284    2e-20 28.8% 0047313 00473131 1/1   lasmic binding protein-like II          
   1::82   2.4e-17 45.1% 0052508 00525081 1/1   ed helix" DNA-binding domain            
   2::88   2.6e-08 32.6% 0043164 00431641 1/1   ed helix" DNA-binding domain            
   1::121  8.1e-05 26.1% 0040266 00402661 1/1   ed helix" DNA-binding domain            
   1::285


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQALERELGVRLLERRPFRLTPAGDLLRREGARLL
00474621   1/1  ----------------------------------------------------------------------
00525091   1/1  ----------------------------------------------------------------------
00499981   1/1  ----------------------------------------------------------------------
00528061   1/1  ----------------------------------------------------------------------
00457901   1/1  ----------------------------------------------------------------------
00459101   1/1  llklkllllleldggllldlrllrlllavaetgsisaAAkalglsqsavsqaikeleellgvpLlertgG
00474611   1/1  ldlrllrlflavaelgsftaAAerlglsqsavsrqikrLEeelgvrLfeRtgrglvlTeaGelllelarr
00473131   1/1  ----------------------------------------------------------------------
00525081   1/1  lllllldlnlLrvflavaelgsftrAAeelglsqsavsralkrLeellgveLfvRtgrglvlTeaGelll
00431641   1/1  -srtrlliLllLlealegelsftelaealglsqstvsrhlkkLeelglver.egkyysLTekGeellell
00402661   1/1  iflllraarllikllgellkrlglsptrlriLalLaesdgpltvselaeelglskstvsralkrLeelGl


                         -         -         *         -         -         -         -:140
query           KELEALKEAVRRAGQEALRFGVPENLLPDLMPLLDHLRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAG
00474621   1/1  ------------vGt..lrigappslaalllppllaafraryPdvelelveglsdelldlllegelDlai
00525091   1/1  -----------------------------FdpaessgtfrigvsdslaltllppllarlrkeaPgvrlel
00499981   1/1  -----------TideldagglsgtlrigappslaalllppllarfraryPdvrlelvegssdelldllre
00528061   1/1  -----------TgglsGtlrigappslaalllppllarfraryPdvrlelveglsdelldllaegelDla
00457901   1/1  -----------TdglsGtLrigappsfaayllppllarfraryPdvrlelveglsdelldllaegelDla
00459101   1/1  gkggrgvvlTeaGerllelarrllaeleeale--------------------------------------
00474611   1/1  llalleealallrdldg-----------------------------------------------------
00473131   1/1  --------------gglsGtLrigappslaalllppllarfraryPdvrlelveglsdelldllaegelD
00525081   1/1  elarrllallee----------------------------------------------------------
00431641   1/1  rellelleellelllell----------------------------------------------------
00402661   1/1  vrrerspgdrrrvyysltekglil.lflerlrellekllelleelleel.l-------------------


                         +         -         -         -         -         *         -:210
query           LKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEPFLLLPKDFLPPLYEAFMEVFRRAGFAP
00474621   1/1  ragplpdpglvarplgeerlvlvaspdhplahgepltledLadhplillsrgsgpglrdlldralaaagl
00525091   1/1  velpsdelleaLregelDlaiaylpigplrdpglvseplfeeplvlvaspdhplagge.ltledlagypl
00499981   1/1  gelDlairygppldpglvarplgeerlvlvaspdhplagrp.ltledLaghplillsr..gsglrdlldr
00528061   1/1  iragpppldpglvarplgeerlvlvaspdhplahgepltledLaghplills..pgsglrdlldralaaa
00457901   1/1  irygpppdppglvarplgeerlvlvaspdhplaagepltledLaghplillsr..gsglrdlldralaaa
00459101   1/1  ----------------------------------------------------------------------
00474611   1/1  ----------------------------------------------------------------------
00473131   1/1  lairygplpdpglvarplgeerlvlvaspdhplahgepltledLaghplillsrg..sglrdlldralaa
00525081   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KVVREVARFSQAVSLVAAGLGVHLTLAPYRVYPHPGVVLRPLEEEAALEVALIYARRPPPPRLEEVRRLL
00474621   1/1  eprivlevnsleallalvaaGlGiallpeslvaelasglvalpldeplpprplylvyrkrllspavrafi
00525091   1/1  ilvspg..sglrrlldealaeaglkprialevdsleallalvaagdgiall..prslaeellaagdlvvl
00499981   1/1  alaaagleprivlevnsleallalvaaGlGial.lpeslvaeelasgrlvalplplplpprplylvwrkr
00528061   1/1  glrprivlevnsleallalvaaGlGiallpeslvadelasgLvalplpdplpprplylvyrkrrllspav
00457901   1/1  gleprivlevnsleallalvaaGlGiallpeslvadela.grLvalplpdplpprplylvyrkrrplspa
00459101   1/1  ----------------------------------------------------------------------
00474611   1/1  ----------------------------------------------------------------------
00473131   1/1  agleprivlevnsleallalvaaGlGiallpeslvaeelasgrLvalplpdplpprplylvyrkrrllsp
00525081   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RALAL-----------------------------------------------------------------
00474621   1/1  dllrel----------------------------------------------------------------
00525091   1/1  plpl------------------------------------------------------------------
00499981   1/1  rllsp-----------------------------------------------------------------
00528061   1/1  raf-------------------------------------------------------------------
00457901   1/1  vraf------------------------------------------------------------------
00459101   1/1  ----------------------------------------------------------------------
00474611   1/1  ----------------------------------------------------------------------
00473131   1/1  avra------------------------------------------------------------------
00525081   1/1  ----------------------------------------------------------------------
00431641   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------